[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE1507
DDBJ      :CPE1507      probable endo-1,4-beta-xylanase
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  189/915 : Eukaryota  15/199 : Viruses  0/175   --->[See Alignment]
c.6.2
:320 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   82->302 2w3zA PDBj 4e-29 36.8 %
:RPS:PDB   110->318 2cc0A PDBj 1e-22 25.3 %
:RPS:SCOP  83->317 1ny1A  c.6.2.3 * 2e-30 26.4 %
:HMM:SCOP  99->318 2iw0A1 c.6.2.3 * 2e-40 32.8 %
:RPS:PFM   111->208 PF01522 * Polysacc_deac_1 3e-10 38.2 %
:HMM:PFM   109->227 PF01522 * Polysacc_deac_1 7.2e-23 30.3 109/124  
:BLT:SWISS 110->317 XY11A_PSEXY 1e-15 32.0 %
:PROS 207->213|PS00307|LECTIN_LEGUME_BETA
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81213.1 GT:GENE CPE1507 GT:PRODUCT probable endo-1,4-beta-xylanase GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(1760330..1761292) GB:FROM 1760330 GB:TO 1761292 GB:DIRECTION - GB:GENE CPE1507 GB:PRODUCT probable endo-1,4-beta-xylanase GB:NOTE 320 aa, similar to pir:F69829 endo-1,4-beta-xylanase homolog yheN from Bacillus subtilis> (282 aa); 32.3% identity in 192 aa overlap. Putative N-terminal signal sequence was found by PSORT GB:PROTEIN_ID BAB81213.1 LENGTH 320 SQ:AASEQ MSKETLSKRKKKNLEKKYIRRRIGVVLIAIVALVFLGTRIALNHKVEVAKGNTGDEGENKELVMEEATVELPQYKSTDIVPGRNVTFDGKNYAVNVKDVSKMVEGSYEGNEKYVFLTFDDGPSPLTEQVLDILKNENVKGTFFMLGSRLDSGQAPKESLKRAIEEGNAIANHSYSHNFKKLYPGNITDVNYFMDEFRKTNDIMRDVLGVEFDTNVLRMPGGYNSRVYYKDRNLEELDNNLESNKIVSIDWNALNGDAEGKPYTLNEMIDYVKRTSRGKNQVVLLMHDTFGKEKTVKVLPEIIKYYKEEGYEFKTISDANV GT:EXON 1|1-320:0| BL:SWS:NREP 1 BL:SWS:REP 110->317|XY11A_PSEXY|1e-15|32.0|181/602| PROS 207->213|PS00307|LECTIN_LEGUME_BETA|PDOC00278| TM:NTM 1 TM:REGION 23->45| SEG 8->17|krkkknlekk| SEG 19->37|irrrigvvliaivalvflg| SEG 232->241|nleeldnnle| SEG 303->313|kyykeegyefk| BL:PDB:NREP 1 BL:PDB:REP 82->302|2w3zA|4e-29|36.8|209/238| RP:PDB:NREP 1 RP:PDB:REP 110->318|2cc0A|1e-22|25.3|182/192| RP:PFM:NREP 1 RP:PFM:REP 111->208|PF01522|3e-10|38.2|89/123|Polysacc_deac_1| HM:PFM:NREP 1 HM:PFM:REP 109->227|PF01522|7.2e-23|30.3|109/124|Polysacc_deac_1| GO:PFM:NREP 2 GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF01522|IPR002509| GO:PFM GO:0016810|"GO:hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds"|PF01522|IPR002509| RP:SCP:NREP 1 RP:SCP:REP 83->317|1ny1A|2e-30|26.4|212/235|c.6.2.3| HM:SCP:REP 99->318|2iw0A1|2e-40|32.8|201/0|c.6.2.3|1/1|Glycoside hydrolase/deacetylase| OP:NHOMO 461 OP:NHOMOORG 206 OP:PATTERN --------------------------------------------------11---------------- -2--1----------1111-1-111-111111---------------------1---------1--------111----212------1112--------122---11-1-------------------------------111--21--11-1---------1-1-2241--------------------1137676778857778962244537791-152-2-111-226--------------------2---11---------11------1-----111111111111111111-------------111---1111124794444444545-8553555321-1-122-2232-1121--111--1---------------------1--------------------1------------------12------------------------------------------------------111----1------------11--------------1--------------------------------------------1-------1--111--1------------------------------------------------1-----1111-------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-----------------------------1-------------------------1--11--1 ------------651--------------------1--------------1111112----------------------------------1-----------311--------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 237 STR:RPRED 74.1 SQ:SECSTR #################################################################################TccccTGTcccccccccccTTcccccTcccEEEEEEEEccccTTHHHHHHHHHHTTcccEEEEcHHHHHHcHHHHHHHHHHHHTTcEEEEccccccGGGccHHHHHcHHHHHHHHHHHHHHHHHTTcccccccEEccGGGcccHHHHHHHccccEEcHHHHTTcEEcccccTTccEEccGGGTccHHHHHHHHHTccTTcEEEEEcccccHHHHHHHHHHHHHHHHTTEEEcEEcTT## DISOP:02AL 1-12, 50-86| PSIPRED ccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHccHHccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEccccHHHHHHHHHHHHccccEEEEEEccccccccHHHHHHHHHHHcccEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccEEEEcccccccHHHHHHHHHHHHHHHHHHccccEEEcccccccccccHHHHHHHHHHHHHHHcccccEEEEEEccccccHHHHHHHHHHHHHHHcccEEEEcccccc //