[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE1605
DDBJ      :CPE1605      conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  44/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.218.1
:269 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   11->90 3eyjB PDBj 7e-04 28.4 %
:BLT:PDB   159->228 2be3B PDBj 3e-08 43.3 %
:RPS:PDB   25->238 2be3B PDBj 6e-14 24.0 %
:RPS:SCOP  3->233 2be3A1  d.218.1.8 * 6e-20 29.7 %
:HMM:SCOP  23->235 2be3A1 d.218.1.8 * 2.3e-33 23.9 %
:RPS:PFM   103->203 PF04607 * RelA_SpoT 2e-05 32.2 %
:HMM:PFM   66->206 PF04607 * RelA_SpoT 7.5e-29 39.6 111/112  
:HMM:PFM   226->269 PF06428 * Sec2p 0.00047 27.3 44/101  
:HMM:PFM   49->78 PF12415 * rpo132 0.00075 26.7 30/33  
:BLT:SWISS 53->228 YWAC_BACSU 9e-10 28.8 %
:BLT:SWISS 224->269 BRE1_DICDI 3e-04 39.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81311.1 GT:GENE CPE1605 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(1878452..1879261) GB:FROM 1878452 GB:TO 1879261 GB:DIRECTION - GB:GENE CPE1605 GB:PRODUCT conserved hypothetical protein GB:NOTE 269 aa, similar to pir:C59107 hypothetical protein pXO1-131 from Bacillus anthracis virulence plasmid pXO1 (349 aa); 40.2% identity in 266 aa overlap GB:PROTEIN_ID BAB81311.1 LENGTH 269 SQ:AASEQ MRSLNKEVFLQKYPHVEEHIEKNKIKFEDLERIYNDFVKFEGSYYNQADFIANILRSNENVHSVKSRIKNPDRLIEKIIRKTEDRKEKYGEDFYFNEYNYKNEITDLIGIRVLHIFKDQWKDIHDFIIKTWNVIEITANIRDGDDRSIFDNLGIEVISRQSGYRSVHYLVELNFTQDSTTIAEIQVRTIFEEGYGEIDHRLRYSHQEIPEILKSNLLLFNRIVGSADEMASLINMLNNNLDDKDHYYESKLKEKDEEIRKLKEQIEQLK GT:EXON 1|1-269:0| BL:SWS:NREP 2 BL:SWS:REP 53->228|YWAC_BACSU|9e-10|28.8|153/210| BL:SWS:REP 224->269|BRE1_DICDI|3e-04|39.1|46/1080| BL:PDB:NREP 2 BL:PDB:REP 11->90|3eyjB|7e-04|28.4|74/172| BL:PDB:REP 159->228|2be3B|3e-08|43.3|67/184| RP:PDB:NREP 1 RP:PDB:REP 25->238|2be3B|6e-14|24.0|175/184| RP:PFM:NREP 1 RP:PFM:REP 103->203|PF04607|2e-05|32.2|87/112|RelA_SpoT| HM:PFM:NREP 3 HM:PFM:REP 66->206|PF04607|7.5e-29|39.6|111/112|RelA_SpoT| HM:PFM:REP 226->269|PF06428|0.00047|27.3|44/101|Sec2p| HM:PFM:REP 49->78|PF12415|0.00075|26.7|30/33|rpo132| GO:PFM:NREP 1 GO:PFM GO:0015969|"GO:guanosine tetraphosphate metabolic process"|PF04607|IPR007685| RP:SCP:NREP 1 RP:SCP:REP 3->233|2be3A1|6e-20|29.7|185/203|d.218.1.8| HM:SCP:REP 23->235|2be3A1|2.3e-33|23.9|188/0|d.218.1.8|1/1|Nucleotidyltransferase| OP:NHOMO 48 OP:NHOMOORG 45 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------1------------------------------------------------------------------1-----1-----------------------------------------------------------1-11-1--111--1------11-------1----------------------------------------------------------------------------------------------------1-11111111212-----111-------------------------1-------------1--------------------------------------------------------------------------------------------------------------------------------------1---------------1---111---------------------------------------------------2------1-----------------------------------1---------------------------------------1------------------------1----------------------------------------------------------------------------------------------------------------1----------------------------------------------------------1---------------------------------------- ----------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 208 STR:RPRED 77.3 SQ:SECSTR ##########ccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTccccEEEEEEEEccHHHHHHTcHHTcGGGEEEcc#####cTTTHHcccTTcEEEEEEccTTHHHHHHHHHHTcccEEEEEEETTTc###############ccTTccccEEEEEEEEEccTEEEEEEEEEEEHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHH############################### DISOP:02AL 269-270| PSIPRED ccHHHHHHHHHHccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEccHHHHHHHHHHccccccccccccccccHHHHHHHccHHEEEEEEEccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccEEEEEEEEEcccccccEEEEEEEccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc //