[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE1613
DDBJ      :CPE1613      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:121 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   51->69 PF02216 * B 0.00046 52.6 19/54  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81319.1 GT:GENE CPE1613 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(1883647..1884012) GB:FROM 1883647 GB:TO 1884012 GB:DIRECTION - GB:GENE CPE1613 GB:PRODUCT hypothetical protein GB:NOTE 121 aa, no significant homology Putative N-terminal signal sequence was found by PSORT GB:PROTEIN_ID BAB81319.1 LENGTH 121 SQ:AASEQ MKALILVGIILFAVGLLFESMYKIKMVFKSFSKDTNGKAGKDFNFDFKNQFNNISEEKREEFIRSLSDDKKGLFKEYLACNKEDENLLREKLDEKHVFNMFNRWARQNNIEPINISNYKDL GT:EXON 1|1-121:0| TM:NTM 1 TM:REGION 1->23| SEG 41->53|kdfnfdfknqfnn| HM:PFM:NREP 1 HM:PFM:REP 51->69|PF02216|0.00046|52.6|19/54|B| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 120-121| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHcccHHHHHHHHHHHHcccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccc //