[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE1649
DDBJ      :CPE1649      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:266 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   64->116 PF07389 * DUF1500 0.00013 30.2 53/100  
:HMM:PFM   195->244 PF00931 * NB-ARC 0.00033 27.1 48/285  
:BLT:SWISS 61->179 VB06_VACCW 1e-06 29.6 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81355.1 GT:GENE CPE1649 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(1922655..1923455) GB:FROM 1922655 GB:TO 1923455 GB:DIRECTION - GB:GENE CPE1649 GB:PRODUCT hypothetical protein GB:NOTE 266 aa, no significant homology Putative N-terminal signal sequence was found by PSORT GB:PROTEIN_ID BAB81355.1 LENGTH 266 SQ:AASEQ MRKIKVNGIIFLISLISCLFLGGNTALAKENPNTIEFLSYDEEILILRSNGETVLISEGDNVEGIIEGINKENLKEIDLLVLRSMEEETDELIKTFINKSSVKKILLPTLNGVSEEVSNLTNEKNIEIASMEEGFNYNKESISLNAKKVENSKEGMIFATVDNIKLAVLSEESYDSAINLSNIEDCRVEILNLIDSEKENKKEVKKLVKRLKPLVIIDDLDNGKSIEKLGVKYYNLNEEKGLKIMRVLGETKEFKVLSKKEGYTPK GT:EXON 1|1-266:0| BL:SWS:NREP 1 BL:SWS:REP 61->179|VB06_VACCW|1e-06|29.6|108/173| TM:NTM 1 TM:REGION 5->27| SEG 9->21|iiflislisclfl| SEG 197->215|ekenkkevkklvkrlkplv| HM:PFM:NREP 2 HM:PFM:REP 64->116|PF07389|0.00013|30.2|53/100|DUF1500| HM:PFM:REP 195->244|PF00931|0.00033|27.1|48/285|NB-ARC| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 146-148, 197-205, 261-266| PSIPRED ccEEEEcHHHHHHHHHHHHHccccEEEccccccEEEEEEcccEEEEEEccccEEEEEccccHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHccccHHHHHHHccccccEEEEEEccccccccHHEEEEHHHcccccccEEEEEEccEEEEEEEccccccEEcccccHHHHHHHHHHHccccccHHHHHHHHHHcccEEEEEcccccccHHHHccEEEEccHHHcHHHHHHHcccHHEEEEEcccccccc //