[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE1674
DDBJ      :CPE1674      probable phosphatidylglycerophosphate synthase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  820/915 : Eukaryota  103/199 : Viruses  0/175   --->[See Alignment]
:196 amino acids
:PSIPRED
:RPS:PFM   5->72 PF01066 * CDP-OH_P_transf 2e-04 33.8 %
:HMM:PFM   3->108 PF01066 * CDP-OH_P_transf 1.6e-20 25.5 94/102  
:BLT:SWISS 2->194 PGSA_BACSU 5e-39 51.7 %
:PROS 48->70|PS00379|CDP_ALCOHOL_P_TRANSF
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81380.1 GT:GENE CPE1674 GT:PRODUCT probable phosphatidylglycerophosphate synthase GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(1949334..1949924) GB:FROM 1949334 GB:TO 1949924 GB:DIRECTION - GB:GENE CPE1674 GB:PRODUCT probable phosphatidylglycerophosphate synthase GB:NOTE 196 aa, similar to gpu:AP001515_120 phosphatidylglycerophosphate synthase from Bacillus halodurans (192 aa); 46.4% identity in 192 aa overlap. Putative N-terminal signal sequence and 4 putative transmembrane regions were found by PSORT. GB:PROTEIN_ID BAB81380.1 LENGTH 196 SQ:AASEQ MNLANKLTLIRIILVPIFLVFIAYQDLPYGSVIATLIFIIASVTDQLDGYIARSRNQVTNFGKFMDPLADKLLVTAALISLVELQLVPAWAAIVIIAREFAVSGLRTIAASEGLVIAASWWGKIKTVIQIIAIVLLLLQVNIINSPGIKELVAGSSFLRNFFIYVPDIFLYLAVAITIISGVDYFRKNKNVINTYK GT:EXON 1|1-196:0| BL:SWS:NREP 1 BL:SWS:REP 2->194|PGSA_BACSU|5e-39|51.7|172/193| PROS 48->70|PS00379|CDP_ALCOHOL_P_TRANSF|PDOC00321| TM:NTM 4 TM:REGION 13->35| TM:REGION 82->104| TM:REGION 125->147| TM:REGION 157->179| SEG 127->144|viqiiaivllllqvniin| RP:PFM:NREP 1 RP:PFM:REP 5->72|PF01066|2e-04|33.8|68/147|CDP-OH_P_transf| HM:PFM:NREP 1 HM:PFM:REP 3->108|PF01066|1.6e-20|25.5|94/102|CDP-OH_P_transf| GO:PFM:NREP 3 GO:PFM GO:0008654|"GO:phospholipid biosynthetic process"|PF01066|IPR000462| GO:PFM GO:0016020|"GO:membrane"|PF01066|IPR000462| GO:PFM GO:0016780|"GO:phosphotransferase activity, for other substituted phosphate groups"|PF01066|IPR000462| OP:NHOMO 1049 OP:NHOMOORG 923 OP:PATTERN -------------------------------------------------------------------- 1121211111112112222-21111122222111111111222111111112212112111122112222122221111212112222--------------------1-1111111111111112222222222212221---1-1111111--11-1--1-111111111-11111-111------2212111111111111111111111111111111111111111231111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112222111111111112111111122211-111-11111121-12222-11-21---111111221111121111211111111111-111111112211111111-111--22-1111-111111111111111111121-11-111---1111111111111111111111111111111111121111111111111111111-1111-111111111111111111111-1111111111111-111111111112111111112111122121122111111111111111111111111111111-211111111111111111111111211-11111------11111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111222221211111111111-11111111111111111---------111-1---111111111111111111111111111111111111111121222222-----1-1111111-1-111-1111111111111111111111111211 -----------111------11111-111-111-1-11-1-11111-111111-11111111111-------1-11111--1111-----------1-1-1---------21-1111-1---1-21---351-213-1--21--1-1---1--1-11-1---111--3121--1-1121-1--212123-21111---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //