[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE1705
DDBJ      :CPE1705      conserved hypothetical protein
Swiss-Prot:Y1705_CLOPE  RecName: Full=UPF0102 protein CPE1705;

Homologs  Archaea  0/68 : Bacteria  68/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.52.1
:122 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  12->119 2inbA1  c.52.1.32 * 1e-11 17.3 %
:HMM:SCOP  10->112 1hh1A_ c.52.1.18 * 9.2e-26 39.4 %
:RPS:PFM   12->102 PF02021 * UPF0102 6e-14 38.5 %
:HMM:PFM   12->101 PF02021 * UPF0102 8e-28 40.0 90/93  
:BLT:SWISS 1->122 Y1705_CLOPE 2e-57 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81411.1 GT:GENE CPE1705 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 1985322..1985690 GB:FROM 1985322 GB:TO 1985690 GB:DIRECTION + GB:GENE CPE1705 GB:PRODUCT conserved hypothetical protein GB:NOTE 122 aa, similar to pir:A82030 hypothetical protein NMA0341 from Neisseria meningitidis (group A strain Z2491) (115 aa); 28% identity in 100 aa overlap GB:PROTEIN_ID BAB81411.1 LENGTH 122 SQ:AASEQ MKKYNKSIGFYGEDLSVSFLEKEGYSILEKNFNCSSGEIDIIAIKDEIISFIEVKSRFSNSFGNPKESVTCSKQRRIINAAKYYLHIKKLYNYYIRFDVIEINFHIDSSKYELNFLKDAFRV GT:EXON 1|1-122:0| SW:ID Y1705_CLOPE SW:DE RecName: Full=UPF0102 protein CPE1705; SW:GN OrderedLocusNames=CPE1705; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->122|Y1705_CLOPE|2e-57|100.0|122/122| SEG 38->53|eidiiaikdeiisfie| RP:PFM:NREP 1 RP:PFM:REP 12->102|PF02021|6e-14|38.5|91/93|UPF0102| HM:PFM:NREP 1 HM:PFM:REP 12->101|PF02021|8e-28|40.0|90/93|UPF0102| RP:SCP:NREP 1 RP:SCP:REP 12->119|2inbA1|1e-11|17.3|104/128|c.52.1.32| HM:SCP:REP 10->112|1hh1A_|9.2e-26|39.4|99/0|c.52.1.18|1/1|Restriction endonuclease-like| OP:NHOMO 69 OP:NHOMOORG 68 OP:PATTERN -------------------------------------------------------------------- --------------1----------------------1-----------------------------------------------11-------------1-1------1-----------------1-----11-----------------------------------------------------11-------------------------------------------------------------------------------------------------------------------------------------111111111111111-111111111111----1--11-11---1111-1--1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1--------------------1--1----------111-11111----1-12-------------------------------1-------------------------------1--------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5| PSIPRED ccHHHHHHHHHHHHHHHHHHHHcccEEEHHHcccccccEEEEEEcccEEEEEEEEEccccccccHHHcccHHHHHHHHHHHHHHHHHcccccccEEEEEEEEEEcccccccccEEEcccccc //