[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE1711
DDBJ      :CPE1711      hypothetical protein
Swiss-Prot:Y1711_CLOPE  RecName: Full=UPF0109 protein CPE1711;

Homologs  Archaea  0/68 : Bacteria  196/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.52.3
:75 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  2->61 1hh2P3 d.52.3.1 * 1.8e-07 39.7 %
:HMM:PFM   32->61 PF00013 * KH_1 2.2e-07 30.0 30/57  
:BLT:SWISS 1->75 Y1711_CLOPE 2e-36 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81417.1 GT:GENE CPE1711 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(1989238..1989465) GB:FROM 1989238 GB:TO 1989465 GB:DIRECTION - GB:GENE CPE1711 GB:PRODUCT hypothetical protein GB:NOTE 75 aa, similar to sp:Y696_BORBU HYPOTHETICAL PROTEIN BB0696 from Borrelia burgdorferi (82 aa); 55.3% identity in 76 aa overlap GB:PROTEIN_ID BAB81417.1 LENGTH 75 SQ:AASEQ MKELVEIIAKSLVDKPEDVHVNEVLGEESIILELKVSPEDMGKVIGKQGRIAKAIRTVVKAAAIKENKKVVVEII GT:EXON 1|1-75:0| SW:ID Y1711_CLOPE SW:DE RecName: Full=UPF0109 protein CPE1711; SW:GN OrderedLocusNames=CPE1711; SW:KW Complete proteome; RNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->75|Y1711_CLOPE|2e-36|100.0|75/75| GO:SWS:NREP 1 GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| HM:PFM:NREP 1 HM:PFM:REP 32->61|PF00013|2.2e-07|30.0|30/57|KH_1| HM:SCP:REP 2->61|1hh2P3|1.8e-07|39.7|58/68|d.52.3.1|1/1|Prokaryotic type KH domain (KH-domain type II)| OP:NHOMO 208 OP:NHOMOORG 196 OP:PATTERN -------------------------------------------------------------------- 111--------------------------------------------1-111---111----1------111111111--11-11111----------------------11111112222222------------111111111-----------------------------------------1111111111111111111111111111111111111--11111111--------------------1-1-11---------1111---------------------------------------------------111111111111111111111111-1---111111111111111111----1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11211111111111111111111111111-24----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111111111-1-------------------------------1------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 75-76| PSIPRED cHHHHHHHHHHHcccccEEEEEEEEcccEEEEEEEEcHHHEEEEEccccHHHHHHHHHHHHHHcccccEEEEEEc //