[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE1723
DDBJ      :CPE1723      conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  109/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.179.1
:131 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  42->88 1qaxA2  d.179.1.1 * 5e-05 23.4 %
:RPS:PFM   24->129 PF02620 * DUF177 4e-14 43.1 %
:HMM:PFM   23->129 PF02620 * DUF177 2.7e-29 37.4 107/119  
:BLT:SWISS 6->129 Y1660_MYCLE 2e-11 28.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81429.1 GT:GENE CPE1723 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(1999811..2000206) GB:FROM 1999811 GB:TO 2000206 GB:DIRECTION - GB:GENE CPE1723 GB:PRODUCT conserved hypothetical protein GB:NOTE 131 aa, similar to prf:2220209C ORF X from Clostridium acetobutylicum (158 aa); 39.6% identity in 154 aa overlap GB:PROTEIN_ID BAB81429.1 LENGTH 131 SQ:AASEQ MKVIKPLHFTGEVISNESFIELVGNITGELQMKCSRCLTNFSYEVSIDMDEKFTNNSNQEDDSIAYVEGDELDVAEAVVENVISTLPIKRLCSIDCKGLCQKCGIDLNKETCQCDNEEIDLRMAKLMDLFK GT:EXON 1|1-131:0| BL:SWS:NREP 1 BL:SWS:REP 6->129|Y1660_MYCLE|2e-11|28.5|123/217| RP:PFM:NREP 1 RP:PFM:REP 24->129|PF02620|4e-14|43.1|102/116|DUF177| HM:PFM:NREP 1 HM:PFM:REP 23->129|PF02620|2.7e-29|37.4|107/119|DUF177| RP:SCP:NREP 1 RP:SCP:REP 42->88|1qaxA2|5e-05|23.4|47/315|d.179.1.1| OP:NHOMO 109 OP:NHOMOORG 109 OP:PATTERN -------------------------------------------------------------------- 11111----------11-----1111-----11----111------------1-11-1--1111--------------1-11---111---------------------------------------------------11-----------------------------------------------11-1---------------------------------------11------------------------------------------------------------------------------------------111111-1111111111111111111--11111111111111111-1----1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-1--1111111111111--1---11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------11111111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 106-121| PSIPRED ccEEccEEEEEEEEEcccEEEEEEEEEEEEEEEEccccccccEEEEEEEEEEEccccccccccEEEEcccEEcHHHHHHHHHHHHcccEEEccccccccccccccccccccccccccccccHHHHHHHHcc //