[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE1730
DDBJ      :CPE1730      conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  812/915 : Eukaryota  22/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:185 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->181 2fhpA PDBj 3e-21 34.3 %
:RPS:PDB   26->172 3a25A PDBj 2e-13 25.9 %
:RPS:SCOP  28->180 2esrA1  c.66.1.46 * 3e-43 34.0 %
:HMM:SCOP  1->182 2fhpA1 c.66.1.46 * 1.3e-51 37.4 %
:RPS:PFM   1->180 PF03602 * Cons_hypoth95 1e-39 45.0 %
:HMM:PFM   1->181 PF03602 * Cons_hypoth95 4.2e-61 48.6 181/183  
:BLT:SWISS 1->181 YLBH_BACSU 2e-31 37.6 %
:PROS 117->123|PS00092|N6_MTASE

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81436.1 GT:GENE CPE1730 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2006399..2006956) GB:FROM 2006399 GB:TO 2006956 GB:DIRECTION - GB:GENE CPE1730 GB:PRODUCT conserved hypothetical protein GB:NOTE 185 aa, similar to gpu:AP001516_19 BH2590 gene product from Bacillus halodurans (189 aa); 35.3% identity in 184 aa overlap GB:PROTEIN_ID BAB81436.1 LENGTH 185 SQ:AASEQ MRIIAGKARGRKLLSPPTYETRPTLDRVKESMFSMIQWYIPDAVVIDVFAGTGSLGLEAASRGAKECYLVDKSPVTFPVLKKNIENLGFGDFCHALNTDAYSALRSLASRGKVFDLMFIDPPYMKNLIPEAIEIIEEKNLLQEDGLIVTKIDSSEEIFEGTEKIKLTKVKKYGNTTVCFYKIEED GT:EXON 1|1-185:0| BL:SWS:NREP 1 BL:SWS:REP 1->181|YLBH_BACSU|2e-31|37.6|181/184| PROS 117->123|PS00092|N6_MTASE|PDOC00087| BL:PDB:NREP 1 BL:PDB:REP 2->181|2fhpA|3e-21|34.3|175/177| RP:PDB:NREP 1 RP:PDB:REP 26->172|3a25A|2e-13|25.9|143/264| RP:PFM:NREP 1 RP:PFM:REP 1->180|PF03602|1e-39|45.0|180/182|Cons_hypoth95| HM:PFM:NREP 1 HM:PFM:REP 1->181|PF03602|4.2e-61|48.6|181/183|Cons_hypoth95| RP:SCP:NREP 1 RP:SCP:REP 28->180|2esrA1|3e-43|34.0|150/152|c.66.1.46| HM:SCP:REP 1->182|2fhpA1|1.3e-51|37.4|182/0|c.66.1.46|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 845 OP:NHOMOORG 834 OP:PATTERN -------------------------------------------------------------------- 111-1----------1111-11----11111-1111-1111111--11----111-11111111111111111111-111111--11-1111-111---1111111--111111111111111111111111111211111111111111111--1111111111111111-1--1--111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11112221-11211111111111111111111111111111111111-11111111111111111111111111111111-1--111111111111--11111111111111111-1111-1------1111111111-11111----11----1111------1111111111111111-1111-111111111111111111111111111111111111111111111111111111211111----11111111111111-111111111111111111111111111111111--11111--111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112-1111111111111111111111111111111------11111111-1111111-11-11--1111---11---1111111111111 11------1---------------------------------------------------------------------------------------------------1------------------------------------------------------------------11-13111111121-111-1---1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 184 STR:RPRED 99.5 SQ:SECSTR EEEEEETTTEEEEEETTEccccTTcGGGHHHHHHHHHHccTTcEEEETTcTTTTTHHHHHHHTccEEEEEcccHHHHHHHHHHHHHTTcTTTEEEEcccGHHHHGGccccccEEEEEEcccccGGGGHHHHHHHEEEcGGGTTTTTHHHHHHHHHTTTcEEEEEEEEEcccccEEEEEEEETTE# DISOP:02AL 185-186| PSIPRED cEEEEEEEccEEEEccccccccccHHHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHcccccEEEEEEccHHHHHHHHHHcccccEEEEEccccccccHHHHHHHHHHccccccccEEEEEEcccccccccccccEEEEEEEcccEEEEEEEEccc //