[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE1749
DDBJ      :CPE1749      conserved hypothetical protein
Swiss-Prot:Y2002_CLOP1  RecName: Full=UPF0296 protein CPF_2002;

Homologs  Archaea  0/68 : Bacteria  127/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:89 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   5->77 PF04025 * DUF370 3e-26 83.6 %
:HMM:PFM   5->77 PF04025 * DUF370 5.4e-43 79.5 73/73  
:BLT:SWISS 1->89 Y2002_CLOP1 4e-45 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81455.1 GT:GENE CPE1749 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2025914..2026183) GB:FROM 2025914 GB:TO 2026183 GB:DIRECTION - GB:GENE CPE1749 GB:PRODUCT conserved hypothetical protein GB:NOTE 89 aa, similar to gpu:AP001515_247 BH2513 gene product from Bacillus halodurans (87 aa); 88.8% identity in 80 aa overlap GB:PROTEIN_ID BAB81455.1 LENGTH 89 SQ:AASEQ MSIKLINIGFGNIVSANRLVAIVSPESAPIKRIIQEARDRGMLIDATYGRRTRAVIITDSDHVILSAVQPETVAHRLSTKEEVVVEDDE GT:EXON 1|1-89:0| SW:ID Y2002_CLOP1 SW:DE RecName: Full=UPF0296 protein CPF_2002; SW:GN OrderedLocusNames=CPF_2002; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->89|Y2002_CLOP1|4e-45|100.0|89/89| RP:PFM:NREP 1 RP:PFM:REP 5->77|PF04025|3e-26|83.6|73/73|DUF370| HM:PFM:NREP 1 HM:PFM:REP 5->77|PF04025|5.4e-43|79.5|73/73|DUF370| OP:NHOMO 129 OP:NHOMOORG 127 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------111--11111111111------111-1111-----------------11---1111111111111121111111111111-1--------11------------------------------------------------------------------------------------------1111111111111111-1111111-1-11--11111111111111-11---1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111111-----------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111------------------------------------1211111111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 79-89| PSIPRED ccEEEEEEccccEEEccEEEEEEcccccHHHHHHHHHHHcccEEEEccccEEEEEEEEccccEEEEEcccHHHHHEEEccccccccccc //