[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE1758
DDBJ      :CPE1758      conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  465/915 : Eukaryota  40/199 : Viruses  0/175   --->[See Alignment]
d.194.1
:234 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   44->233 1u05A PDBj 2e-14 30.3 %
:RPS:SCOP  26->234 1rv9A  d.194.1.2 * 5e-50 28.5 %
:HMM:SCOP  4->234 1xfjA_ d.194.1.2 * 1.2e-51 31.4 %
:RPS:PFM   54->232 PF02578 * Cu-oxidase_4 3e-33 39.0 %
:HMM:PFM   29->232 PF02578 * Cu-oxidase_4 4.1e-62 38.1 202/233  
:BLT:SWISS 6->231 Y1699_CLOAB 3e-48 45.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81464.1 GT:GENE CPE1758 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2037806..2038510) GB:FROM 2037806 GB:TO 2038510 GB:DIRECTION - GB:GENE CPE1758 GB:PRODUCT conserved hypothetical protein GB:NOTE 234 aa, similar to prf:2022232K sigG downstream ORF W from Clostridium acetobutylicum (147 aa); 45.1% identity in 133 aa overlap GB:PROTEIN_ID BAB81464.1 LENGTH 234 SQ:AASEQ MKREIIDNKEFIVFNDGNIKVRFSTALNNVNYKKEDEEGKKNLEDLKEIFKVDKVVYVNQTHSSDFIDATFENFKGDRDCDSLVTTDKNTLIGVFTADCVPVIAYDKEKEVIAAIHSGWKGTYNKIARKTCEYMKEKYGCENIKVIIGPHVRQCCYEVSEDLAEKFSEEFGKEVCNGRMLNLEKCVEIQLKGIVKKENITSTRICTYCEKEVKMHSYRQDQEKSGRLFSSIFID GT:EXON 1|1-234:0| BL:SWS:NREP 1 BL:SWS:REP 6->231|Y1699_CLOAB|3e-48|45.5|222/236| BL:PDB:NREP 1 BL:PDB:REP 44->233|1u05A|2e-14|30.3|185/243| RP:PFM:NREP 1 RP:PFM:REP 54->232|PF02578|3e-33|39.0|177/233|Cu-oxidase_4| HM:PFM:NREP 1 HM:PFM:REP 29->232|PF02578|4.1e-62|38.1|202/233|Cu-oxidase_4| RP:SCP:NREP 1 RP:SCP:REP 26->234|1rv9A|5e-50|28.5|200/242|d.194.1.2| HM:SCP:REP 4->234|1xfjA_|1.2e-51|31.4|226/256|d.194.1.2|1/1|CNF1/YfiH-like putative cysteine hydrolases| OP:NHOMO 509 OP:NHOMOORG 505 OP:PATTERN -------------------------------------------------------------------- 1111-1111111------------1------1--------------1------------------------111111111-11111111111-1--1---------111--------111-----111111111-1--------11-1--11--1----11-11-1----11-1-----1-1-111--111111111111111111111111111111111111-------1111111111111111-11111----------------------------------------------------------------------111111111111111111111111-1--1111111111111111111-11-1----11111111-11-11111-111111111111-11111111111-1--11111111111-11111111111111111111-----111----------111111111111111--------111---1--------------1---------------------------------111------1--------11111---------11111111111111111111-11111111-1-------11-11----111-111111--------------1--1--1----------1----1-1111111111-1111111111111111111121-----111111111111111111111111--111111111111---1111111111----111111111-11111-------1-----1111-1-1---------1111111111-1111111111111----------------1111111111111111----------------------------1--11-------- --------------------------------------------------------------------------------------------------------------1111-11-1111111111-221-11111-111111-1-1---1112111--------------1------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 226 STR:RPRED 96.6 SQ:SECSTR ########EEEEEccccccccGGGccccccccccccHHHHHHHHHHHHHHHHcccccccccccccEEEcccccccccccccEEEEcccTcEEEEEEcccEEEEEEETTcccEEEEEEcHHHHHTTHHHHHHTTccccccGGGEEEEEcccccTTTcEEcHHHHHHHHTTcGGGGGGEEEETTEEEEcHHHHHHHTccEEEEccccTTTcTTTTcccHHHHTcccccEEEEEEEc PSIPRED ccEEEcccEEEEEEEccccccccccccccccccccHHHHHHHHHHHHHHcccccEEEEEcccccEEEEcccccccccccccEEEEcccccEEEEEccccEEEEEEEccccEEEEEEccHHHHHHHHHHHHHHHHHHccccccEEEEEccccccccEEEcHHHHHHHHHHccHHHccccEEcHHHHHHHHHHccccccEEEEccccccccccccccEEEccccccccEEEEEEEc //