[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE1789
DDBJ      :CPE1789      conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  83/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.58.1
:142 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   66->104 1o65C PDBj 4e-04 38.5 %
:RPS:PDB   62->139 3cdxC PDBj 8e-04 16.2 %
:HMM:SCOP  1->142 1oruA_ b.58.1.2 * 5.5e-41 42.6 %
:RPS:PFM   42->141 PF03473 * MOSC 6e-08 37.0 %
:HMM:PFM   30->141 PF03473 * MOSC 2.9e-24 34.5 110/133  
:BLT:SWISS 62->142 Y278_HAEIN 3e-06 35.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81495.1 GT:GENE CPE1789 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2068563..2068991) GB:FROM 2068563 GB:TO 2068991 GB:DIRECTION - GB:GENE CPE1789 GB:PRODUCT conserved hypothetical protein GB:NOTE 142 aa, similar to gp:AB017192_13 hypothetical 15.6-kDa protein from Clostridium perfringens (142 aa); 97.9% identity in 142 aa overlap GB:PROTEIN_ID BAB81495.1 LENGTH 142 SQ:AASEQ MSKVRAICISEKKGTAKVQVPEAEFIEDFGIKGDAHAGKWHRQVSLLAFEKIEDFRADGGNVDFGAFGENLVVDGIELNKLPIGQKIKIGEVLLEVTQIGKKCHDKCAIYYQVGRCIMPAYGIFTKVLNGGEITLGEEVELL GT:EXON 1|1-142:0| BL:SWS:NREP 1 BL:SWS:REP 62->142|Y278_HAEIN|3e-06|35.5|76/221| BL:PDB:NREP 1 BL:PDB:REP 66->104|1o65C|4e-04|38.5|39/217| RP:PDB:NREP 1 RP:PDB:REP 62->139|3cdxC|8e-04|16.2|68/325| RP:PFM:NREP 1 RP:PFM:REP 42->141|PF03473|6e-08|37.0|100/139|MOSC| HM:PFM:NREP 1 HM:PFM:REP 30->141|PF03473|2.9e-24|34.5|110/133|MOSC| GO:PFM:NREP 3 GO:PFM GO:0003824|"GO:catalytic activity"|PF03473|IPR005302| GO:PFM GO:0030151|"GO:molybdenum ion binding"|PF03473|IPR005302| GO:PFM GO:0030170|"GO:pyridoxal phosphate binding"|PF03473|IPR005302| HM:SCP:REP 1->142|1oruA_|5.5e-41|42.6|141/182|b.58.1.2|1/1|PK beta-barrel domain-like| OP:NHOMO 95 OP:NHOMOORG 83 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------1---------------1111-------------------------------------------111111111--111-----------------------------------------------11-----------------------------------------------------------------1---------------------------------------------------------------------11212111111111111---1111--11--11111-222-11121-1----1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-11--111-111-212221211------1-1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------1-------------------------------------------12---1------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 68 STR:RPRED 47.9 SQ:SECSTR #############################################################cccGGGEEEccccEEEEEcccTTcEEcTTcEEEEETccccccEEEEc##########cccEEEEEEEcccEEcTTcEE### PSIPRED ccEEEEEEEccccccccEEccHHHEEcccccccccccccccccEEEEEHHHHHHHHHHcccccHHHcccEEEEEcccHHHcccccEEEEcEEEEEEEcccccHHHHHHHcccccccccccccEEEEEEcccEEccccEEEEc //