[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE1792
DDBJ      :CPE1792      molybdopterin-guanine dinucleotide biosynthesis protein A
Swiss-Prot:MOBA_CLOPE   RecName: Full=Probable molybdopterin-guanine dinucleotide biosynthesis protein A;

Homologs  Archaea  12/68 : Bacteria  69/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.68.1
:182 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   40->124 1hjlA PDBj 3e-06 30.1 %
:RPS:PDB   3->169 2e8bA PDBj 5e-07 18.4 %
:RPS:SCOP  56->91 2dpwA1  c.68.1.19 * 7e-07 28.6 %
:HMM:SCOP  1->177 1e5kA_ c.68.1.8 * 1.4e-14 20.2 %
:HMM:PFM   18->102 PF01983 * CofC 1.7e-06 22.0 82/217  
:HMM:PFM   143->173 PF00183 * HSP90 0.00045 45.2 31/531  
:BLT:SWISS 1->182 MOBA_CLOPE 6e-98 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81498.1 GT:GENE CPE1792 GT:PRODUCT molybdopterin-guanine dinucleotide biosynthesis protein A GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2071201..2071749) GB:FROM 2071201 GB:TO 2071749 GB:DIRECTION - GB:GENE CPE1792 GB:PRODUCT molybdopterin-guanine dinucleotide biosynthesis protein A GB:NOTE 182 aa, similar to gp:AB017192_10 molybdopterin-guanine dinucleotide biosynthesis protein A from Clostridium perfringens (198 aa); 92.4% identity in 198 aa overlap GB:PROTEIN_ID BAB81498.1 LENGTH 182 SQ:AASEQ MNYRNKAFLKYEEDYFIERIIKALKDYEEIIIISNNPEEYKEFGLKVFKDIYPSQGPLSGIHSALNHIKNDYCLVVACDMPFINKDVVNYLGNIKEDYEILIPKFQERLQPLCAIYKKSCKDIMEKELINNSNKLIKTCFKFSMKVVEEFPFIEKVHKKEIKNFYNINTVDEYEDLIKKKEI GT:EXON 1|1-182:0| SW:ID MOBA_CLOPE SW:DE RecName: Full=Probable molybdopterin-guanine dinucleotide biosynthesis protein A; SW:GN Name=mobA; OrderedLocusNames=CPE1792; SW:KW Complete proteome; Cytoplasm; GTP-binding;Molybdenum cofactor biosynthesis; Nucleotide-binding. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->182|MOBA_CLOPE|6e-98|100.0|182/198| GO:SWS:NREP 4 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0005525|"GO:GTP binding"|GTP-binding| GO:SWS GO:0006777|"GO:Mo-molybdopterin cofactor biosynthetic process"|Molybdenum cofactor biosynthesis| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| SEG 28->39|eeiiiisnnpee| BL:PDB:NREP 1 BL:PDB:REP 40->124|1hjlA|3e-06|30.1|83/188| RP:PDB:NREP 1 RP:PDB:REP 3->169|2e8bA|5e-07|18.4|158/185| HM:PFM:NREP 2 HM:PFM:REP 18->102|PF01983|1.7e-06|22.0|82/217|CofC| HM:PFM:REP 143->173|PF00183|0.00045|45.2|31/531|HSP90| RP:SCP:NREP 1 RP:SCP:REP 56->91|2dpwA1|7e-07|28.6|35/231|c.68.1.19| HM:SCP:REP 1->177|1e5kA_|1.4e-14|20.2|168/0|c.68.1.8|1/1|Nucleotide-diphospho-sugar transferases| OP:NHOMO 93 OP:NHOMOORG 81 OP:PATTERN -----------------------11-------------1---1111-11-111--------------- -11---------------------------------------------------------------------------------1111-------------1---------------------------------------111-1----11-----------------------------------------1-------11--1----1--1----1-1----------1---------------------1---------------------------------------------------------------------113-1----------11---111----11--1111111--111---1----1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111------1----3331213-111-11-11--------------------1---1-----------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------1-----------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 176 STR:RPRED 96.7 SQ:SECSTR cccTTHHHHHHHHHHHHHHHHHHHHTTccEEEEEEcccGGGGGTccEEEcccccccHHHHHHHHHHHccccEEEEEETTcTTccHHHHHHHHHTccccEEEEEccTTcEEEEEEEEEGGGHHHHHHHHHTTcccHHHHHHHHccEEEEccEEEcccEGGGGGGGcccccHHHHHHH###### DISOP:02AL 181-182| PSIPRED cccccccEEEEccEEHHHHHHHHHcccccEEEEEccHHHHHHcccEEEEEcccccccHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHcccccEEEEccccccccEEEEEcHHHHHHHHHHHHHccccHHHHHHHcccEEEEEccHHHccccccHHHHcccccHHHHHHHHHHccc //