[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE1804
DDBJ      :CPE1804      conserved hypothetical protein
Swiss-Prot:SCPB_CLOPE   RecName: Full=Segregation and condensation protein B;

Homologs  Archaea  4/68 : Bacteria  515/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:195 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   26->171 1t6sA PDBj 9e-18 31.9 %
:RPS:SCOP  14->93 1t6sA1  a.4.5.60 * 3e-12 26.6 %
:RPS:SCOP  111->171 1t6sA2  a.4.5.60 * 3e-07 44.3 %
:HMM:SCOP  11->94 1t6sA1 a.4.5.60 * 1.6e-17 37.3 %
:HMM:SCOP  95->171 1t6sA2 a.4.5.60 * 2.8e-25 58.4 %
:RPS:PFM   20->180 PF04079 * DUF387 1e-32 43.1 %
:HMM:PFM   21->180 PF04079 * DUF387 4.1e-58 50.0 158/159  
:BLT:SWISS 1->195 SCPB_CLOPE 2e-99 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81510.1 GT:GENE CPE1804 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2083564..2084151) GB:FROM 2083564 GB:TO 2084151 GB:DIRECTION - GB:GENE CPE1804 GB:PRODUCT conserved hypothetical protein GB:NOTE 195 aa, similar to gpu:AP001512_148 BH1561 gene product from Bacillus halodurans (197 aa); 41.4% identity in 174 aa overlap GB:PROTEIN_ID BAB81510.1 LENGTH 195 SQ:AASEQ MSDINQIEFSEISKKDELKSIIESLLFVSGEPLALKDICRIVEEDFKYVEDLMRELMNIYNGDSSRGIKIISLNGTYQLVTKTKNSEYVQKLLKKNVRQSLSQASLESLAIICYKQPITRVEIDEIRGVKSESAIQRLVEKNLVEETGRLEVPGRPILYGTTDEFLRHFALNDLGDLPSIELFEENDEVSDMVEE GT:EXON 1|1-195:0| SW:ID SCPB_CLOPE SW:DE RecName: Full=Segregation and condensation protein B; SW:GN Name=scpB; Synonyms=hypB; OrderedLocusNames=CPE1804; SW:KW Cell cycle; Cell division; Chromosome partition; Complete proteome;Cytoplasm. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->195|SCPB_CLOPE|2e-99|100.0|195/195| GO:SWS:NREP 4 GO:SWS GO:0007049|"GO:cell cycle"|Cell cycle| GO:SWS GO:0051301|"GO:cell division"|Cell division| GO:SWS GO:0007059|"GO:chromosome segregation"|Chromosome partition| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| SEG 99->110|qslsqaslesla| BL:PDB:NREP 1 BL:PDB:REP 26->171|1t6sA|9e-18|31.9|144/162| RP:PFM:NREP 1 RP:PFM:REP 20->180|PF04079|1e-32|43.1|160/160|DUF387| HM:PFM:NREP 1 HM:PFM:REP 21->180|PF04079|4.1e-58|50.0|158/159|DUF387| RP:SCP:NREP 2 RP:SCP:REP 14->93|1t6sA1|3e-12|26.6|79/85|a.4.5.60| RP:SCP:REP 111->171|1t6sA2|3e-07|44.3|61/77|a.4.5.60| HM:SCP:REP 11->94|1t6sA1|1.6e-17|37.3|83/0|a.4.5.60|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 95->171|1t6sA2|2.8e-25|58.4|77/0|a.4.5.60|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 525 OP:NHOMOORG 520 OP:PATTERN -----------------------1-------------------------1--------1-1------- 111---------1-11-11-11111111111111111-111-1-1---1111111--1--111-1111111----1111111-----------------------11-1---------------111111111-1111111---11------------------1------------------111111111111111111111111111111111111111111111111111111111-111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11-1-111111111-111111--------11111-111---1----------1---------23----1---------1111--1111111111111111111111111-----------------------------111-1-1111111111111111111111111111111111111111111-11111111111111-------11111111-1-----------111111111111111---------------------------1111-111-111-1111111111111111111--11111--------------------------------------------------------------------------------------------1111111111111-----------------11111111111111111111111111111------------------------11111111111111---1111111--------11-----1-1111111111111111111-1---1---1-1- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 156 STR:RPRED 80.0 SQ:SECSTR ###############HHHHHHHHHHHHHccccccHHHHHHHTTccccHHHHHHHHHHHHHHHHHTccEEEEEETTEEEEEEcGGGHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccEEHHHHHHHHTcccccHHHHHHHTTcEEEEEEcccTTccEEEEEcHHHHHHTTc######################## DISOP:02AL 1-15, 189-195| PSIPRED ccccccccccccccHHHHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccEEEEEEccEEEEEEHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHccccHHHHHHHcccccHHHHHHHHHcccEEEccccccccccEEHHccHHHHHHcccccHHHccccccHHHHHHHHHHHcc //