[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE1805
DDBJ      :CPE1805      conserved hypothetical protein
Swiss-Prot:SCPA_CLOPE   RecName: Full=Segregation and condensation protein A;

Homologs  Archaea  0/68 : Bacteria  540/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.4.5c.1.15
:248 amino acids
:PSIPRED
:RPS:SCOP  1->124 1bhwA  c.1.15.3 * 1e-14 13.4 %
:RPS:SCOP  180->243 1w1wE  a.4.5.57 * 3e-09 30.2 %
:RPS:PFM   21->243 PF02616 * ScpA_ScpB 1e-22 37.8 %
:HMM:PFM   21->242 PF02616 * ScpA_ScpB 1.5e-35 32.1 218/242  
:BLT:SWISS 1->248 SCPA_CLOPE e-138 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81511.1 GT:GENE CPE1805 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2084144..2084890) GB:FROM 2084144 GB:TO 2084890 GB:DIRECTION - GB:GENE CPE1805 GB:PRODUCT conserved hypothetical protein GB:NOTE 248 aa, similar to gpu:AP001512_147 BH1560 gene product from Bacillus halodurans (260 aa); 38% identity in 234 aa overlap GB:PROTEIN_ID BAB81511.1 LENGTH 248 SQ:AASEQ MEMPIIKLKNFDGPFDLLLHLIKKNEMSITEIKIHEITKQYLEYIALMKELDLEITSEFIVMAATLIEIKSKSLLPKVKVEDETCEEDLQKILMEKLQEYKKFKKISAYLRERELSTGEVFTKKAEIIEVEVDNKLDDDYFKNITMLDLYKLYNNLMRIYGEKQNVNVMEKKISVDKYKITDKINFLRDKLSEKSIVRFSEFIPQCECKLEVVVTFMAMLELIKRSEIKVVQYENFGEIMMEKVIVNE GT:EXON 1|1-248:0| SW:ID SCPA_CLOPE SW:DE RecName: Full=Segregation and condensation protein A; SW:GN Name=scpA; OrderedLocusNames=CPE1805; SW:KW Cell cycle; Cell division; Chromosome partition; Complete proteome;Cytoplasm. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->248|SCPA_CLOPE|e-138|100.0|248/248| GO:SWS:NREP 4 GO:SWS GO:0007049|"GO:cell cycle"|Cell cycle| GO:SWS GO:0051301|"GO:cell division"|Cell division| GO:SWS GO:0007059|"GO:chromosome segregation"|Chromosome partition| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| RP:PFM:NREP 1 RP:PFM:REP 21->243|PF02616|1e-22|37.8|217/220|ScpA_ScpB| HM:PFM:NREP 1 HM:PFM:REP 21->242|PF02616|1.5e-35|32.1|218/242|ScpA_ScpB| RP:SCP:NREP 2 RP:SCP:REP 1->124|1bhwA|1e-14|13.4|119/392|c.1.15.3| RP:SCP:REP 180->243|1w1wE|3e-09|30.2|63/70|a.4.5.57| OP:NHOMO 542 OP:NHOMOORG 541 OP:PATTERN -------------------------------------------------------------------- 111-111111111111111-11111111111111111111111111-111111111-1--111-1111111----1111111-----------------------11-1---------------111111111-11111---------------------------------------------------111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11-1--11111111-11111---------1--111-111--111111111111---------11--1111111111111111-1--1111-1-11111111111----1--------------------------------11-111111111111111111111111111111111111111111111111111111111111111111111-111-1-----------111111111111111---------------------------111--111-111-1111111111111111111--11111--------------------------------------------------------------------------------------------11111111111111----------------11111111111111111111111111111------------------------11111111111111---1111111--------11-----1-1111-1-111111-1111111-1111111-1- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cccEEEEccccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHccccccccHHHHHHHHHHHHHHHHHcccccccEEEEccccccHHHHHHHHHHHHHccccEEHHHHccccccHHHHHHHHHHHHHHHHcccEEEEEccccccEEEEEEEccc //