[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE1837
DDBJ      :CPE1837      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:146 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   67->97 PF05427 * FIBP 5.9e-05 32.3 31/361  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81543.1 GT:GENE CPE1837 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2110230..2110670) GB:FROM 2110230 GB:TO 2110670 GB:DIRECTION - GB:GENE CPE1837 GB:PRODUCT hypothetical protein GB:NOTE 146 aa, no significant homology 1 putative transmembrane region was found by PSORT GB:PROTEIN_ID BAB81543.1 LENGTH 146 SQ:AASEQ MRLEVRRIYIKKYKNFLPIEYVEEYNRKIKKKLNIYILFLLLFNLFFYGKIKTENNKIKNYLSEIKGVNMERSLDKEFLEDINKLKEIIKDEKILNLNLERKSFELEVNSIYKNSLINYINKINGRVYDISLNESNNTYRLKGELR GT:EXON 1|1-146:0| TM:NTM 1 TM:REGION 33->50| SEG 25->48|ynrkikkklniyilflllfnlffy| SEG 79->97|ledinklkeiikdekilnl| HM:PFM:NREP 1 HM:PFM:REP 67->97|PF05427|5.9e-05|32.3|31/361|FIBP| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 145-146| PSIPRED cccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEcccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccccEEEEEEcccEEEEHHHHHHHHHHHHHHHHHccEEEEEEEcccccEEEEEEccc //