[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE1838
DDBJ      :CPE1838      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:216 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   66->184 1xipA PDBj 6e-04 34.6 %
:HMM:PFM   11->75 PF03587 * EMG1 0.00073 21.4 56/202  
:BLT:SWISS 27->101 ODO1_BUCAI 3e-04 31.0 %
:BLT:SWISS 109->216 TIG_CLOPS 9e-05 35.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81544.1 GT:GENE CPE1838 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2110630..2111280) GB:FROM 2110630 GB:TO 2111280 GB:DIRECTION - GB:GENE CPE1838 GB:PRODUCT hypothetical protein GB:NOTE 216 aa, no significant homology GB:PROTEIN_ID BAB81544.1 LENGTH 216 SQ:AASEQ MMILSCQKGEIMSLLIKTLVINDTNDISKLKELKDKRVKFILLNEKIFIEILRVDKKCDVEEKIEQLIRDRFFNYTPLVHYEVLKYNKSLFLIVYFIGCDERFKSLLYERKDFSLTFPELKNKNILSFKKATFELKNLKISIYIKGKLVLLKSVKDSNIIEVIEESLKGLEKDFGVSLKDFTFKIQKEYLKEEIKEWFKGLKLNEIRGEENLYQKI GT:EXON 1|1-216:0| BL:SWS:NREP 2 BL:SWS:REP 27->101|ODO1_BUCAI|3e-04|31.0|71/909| BL:SWS:REP 109->216|TIG_CLOPS|9e-05|35.8|81/428| BL:PDB:NREP 1 BL:PDB:REP 66->184|1xipA|6e-04|34.6|107/364| HM:PFM:NREP 1 HM:PFM:REP 11->75|PF03587|0.00073|21.4|56/202|EMG1| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 107 STR:RPRED 49.5 SQ:SECSTR #################################################################HHHHHHHHcccccc####ccEEEEcTTEEEE##EEETTEEEEEEccEEEEEcccTTcEEEEEccccEEEEEE######cccEEEEEETTcEEEEEETTTccEEEEEEcEEEEETTccEE################################ DISOP:02AL 1-7, 210-216| PSIPRED cEEEEccccHHHHHHHHHHHccccHHHHHHHHHHHccEEEEEEcHHHHHHHHHccccccHHHHHHHHHHHHHcccccHHHHHHHHHcccEEEEEEEEcccHHHHHHHcccccccccHHHHccccEEEEEcccEEEEHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHcccHHHcEEHHHHHHHHHHHHHHHHHHHHHHHcEEEEEccccHHHccc //