[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE1840
DDBJ      :CPE1840      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:96 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   51->88 PF05326 * SVA 0.00043 26.3 38/124  
:BLT:SWISS 31->84 RL23_FINM2 6e-04 46.2 %
:REPEAT 2|2->22|23->44

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81546.1 GT:GENE CPE1840 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2111613..2111903) GB:FROM 2111613 GB:TO 2111903 GB:DIRECTION - GB:GENE CPE1840 GB:PRODUCT hypothetical protein GB:NOTE 96 aa, no significant homology GB:PROTEIN_ID BAB81546.1 LENGTH 96 SQ:AASEQ MYLNHRFWDNMVEDIKINKDEDYIVVKFWRKGIVEENKIEKKEDKLHVYYISSGENRNHILIENVEEFDVVEKKNLFYIKLKVKNQEERIYCYEKA GT:EXON 1|1-96:0| BL:SWS:NREP 1 BL:SWS:REP 31->84|RL23_FINM2|6e-04|46.2|52/100| NREPEAT 1 REPEAT 2|2->22|23->44| HM:PFM:NREP 1 HM:PFM:REP 51->88|PF05326|0.00043|26.3|38/124|SVA| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED cccccHHHcccHHHEEEcccccEEEEEEEcccccccccccccccEEEEEEEEccccccEEEEEcccccccEEcccEEEEEEEEEccccEEEEEEcc //