[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE1845
DDBJ      :CPE1845      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  17/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.68.7
:343 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   138->217 1dt9A PDBj 3e-05 32.5 %
:RPS:PDB   85->284 1c5kA PDBj 2e-08 20.1 %
:HMM:SCOP  113->339 1k32A2 b.68.7.1 * 2.2e-11 21.4 %
:HMM:PFM   171->291 PF00930 * DPPIV_N 1.1e-06 26.3 114/353  
:HMM:PFM   1->23 PF08085 * Entericidin 0.00067 45.5 22/42  
:BLT:SWISS 138->251 ERF1_XENLA 1e-05 28.9 %
:BLT:SWISS 230->333 PK1_ASFK5 1e-04 31.7 %
:REPEAT 2|91->195|234->331
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81551.1 GT:GENE CPE1845 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2115485..2116516) GB:FROM 2115485 GB:TO 2116516 GB:DIRECTION - GB:GENE CPE1845 GB:PRODUCT hypothetical protein GB:NOTE 343 aa, no significant homology GB:PROTEIN_ID BAB81551.1 LENGTH 343 SQ:AASEQ MRKAAALSLLVLVILSTTLAGCNFGKGSNEEDSKGTNLKLPCSIVSTISGEDVLYYEIEGDSLKKLDLDLKGHMEVYSEELGLAVYREFADKGTNLIITNGVKEHKISVEGNIEELIISPKGTKLLYRYNSGDKIGYKVLDLQNFKEFDFNENLAISGENVKFVNEDQLILYGVDLEKRQSGLYIYNIKDGSYTLEKQIVKAFIDYIDLVEDQVVLYTQSSIDGKKNCYIYNLDSKKESVISNEVGEIESLCKIGNVVYFIGTKGEGLRSLYSIDITNNKLDRLVYDFPKNISEKSKLIVVGDNIYFLGFNDSKEKNALYRYNLKDKSIKLIDSNKGQYIIIK GT:EXON 1|1-343:0| BL:SWS:NREP 2 BL:SWS:REP 138->251|ERF1_XENLA|1e-05|28.9|114/437| BL:SWS:REP 230->333|PK1_ASFK5|1e-04|31.7|101/299| NREPEAT 1 REPEAT 2|91->195|234->331| SEG 4->20|aaalsllvlvilsttla| SEG 61->71|dslkkldldlk| BL:PDB:NREP 1 BL:PDB:REP 138->217|1dt9A|3e-05|32.5|80/398| RP:PDB:NREP 1 RP:PDB:REP 85->284|1c5kA|2e-08|20.1|194/397| HM:PFM:NREP 2 HM:PFM:REP 171->291|PF00930|1.1e-06|26.3|114/353|DPPIV_N| HM:PFM:REP 1->23|PF08085|0.00067|45.5|22/42|Entericidin| HM:SCP:REP 113->339|1k32A2|2.2e-11|21.4|210/281|b.68.7.1|1/1|Tricorn protease N-terminal domain| OP:NHOMO 17 OP:NHOMOORG 17 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111--11-111-1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 248 STR:RPRED 72.3 SQ:SECSTR ####################################################################################EEEEcTTcccEEEEEETccEEEEcccccEEEEEEcTTccEEEEEEcTTcccEEEEEETTTccEEEcccccccEEEEEEEcTTccEEEEEEcTTTcccEEEEEETTcccEEHcEEccccccEEEEEETTccEEEEEEEETTEEEEEEEETTTccEEEccccccEEEEEcTTccEEEEEEEETTEcEEEEEEETTcccEEEcc#cccccccccE#EEEETTEEEEEcccccccccEEEEEETTTTEEEEEEE######### DISOP:02AL 1-5, 28-32| PSIPRED cccHHHHHHHEEEEEHHHEEEcccccccccHHcccccEEEEEHEEEEEcccEEEEEEcccHHHHHHHHHHHccEEEEEEcEEEEEEEEEccccccEEEEcccccEEEEEEEcEEEEEEcccccEEEEEEccccEEEEEEEEEcccEEEEEccccEEEccEEEEEcccEEEEEEcccccccccEEEEEEccccEEEEEEEEEEEEEEEEEEcccEEEEEEcccccEEEEEEEcccccHHHHHHHHHccEEccEEEccEEEEEEEccccccEEEEEEEccccEEEEEEcccccHHHccccEEEEccEEEEEEEcccccccEEEEEcccccEEEEEEcccEEEEEc //