[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE1848
DDBJ      :CPE1848      conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  15/68 : Bacteria  550/915 : Eukaryota  17/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:375 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->365 3k0bA PDBj 1e-99 52.5 %
:RPS:PDB   69->159 2dirA PDBj 7e-15 18.4 %
:RPS:PDB   157->348 2e58A PDBj 5e-06 10.8 %
:RPS:SCOP  70->307 2ar0A1  c.66.1.45 * 5e-13 13.2 %
:HMM:SCOP  139->374 1o9gA_ c.66.1.29 * 1e-40 32.0 %
:RPS:PFM   163->347 PF01170 * UPF0020 1e-43 45.4 %
:HMM:PFM   162->366 PF01170 * UPF0020 3.6e-47 37.5 168/171  
:HMM:PFM   58->153 PF02926 * THUMP 4.7e-06 20.9 91/93  
:BLT:SWISS 3->368 YPSC_BACSU e-109 53.2 %
:PROS 298->304|PS00092|N6_MTASE

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81554.1 GT:GENE CPE1848 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2119280..2120407) GB:FROM 2119280 GB:TO 2120407 GB:DIRECTION - GB:GENE CPE1848 GB:PRODUCT conserved hypothetical protein GB:NOTE 375 aa, similar to gpu:AP001513_44 BH1771 gene product from Bacillus halodurans (385 aa); 57.1% identity in 364 aa overlap GB:PROTEIN_ID BAB81554.1 LENGTH 375 SQ:AASEQ MDYNLIATATFGLEAVVAKELKELGYEDLKTENGRVHFEGDEMDIAITNLWLRTADRVLIKVAEFKAESFEELFNKTVEIDWSKYIPVDGKMHVVGKSVKSKLFSVPDCQSIVKKAVVKSMSRSYGQDWFTEDGPVYKIEVGLLKDVVTLTIDTSGEGLHKRGYREHSGQAPLKETLAAAMVLLSKWRGEQTLIDPCCGSGTILIEAAMIAKNIAPGLHRKFVSETWPSMDKEIWDQVREGAEKSIKKIPLDITGYDIDSWVLSTAKNNVRKAGLTDCITIEKRNFFDFSTKKKYGYMITNPPYGERIGEKEIVSKLNKHFGEVKEKLDTWDFNILTACPDFQKEFGRKATKNRKLYNGRLLCYYYQYLDNNLKK GT:EXON 1|1-375:0| BL:SWS:NREP 1 BL:SWS:REP 3->368|YPSC_BACSU|e-109|53.2|365/385| PROS 298->304|PS00092|N6_MTASE|PDOC00087| BL:PDB:NREP 1 BL:PDB:REP 3->365|3k0bA|1e-99|52.5|358/374| RP:PDB:NREP 2 RP:PDB:REP 69->159|2dirA|7e-15|18.4|87/98| RP:PDB:REP 157->348|2e58A|5e-06|10.8|158/301| RP:PFM:NREP 1 RP:PFM:REP 163->347|PF01170|1e-43|45.4|185/193|UPF0020| HM:PFM:NREP 2 HM:PFM:REP 162->366|PF01170|3.6e-47|37.5|168/171|UPF0020| HM:PFM:REP 58->153|PF02926|4.7e-06|20.9|91/93|THUMP| RP:SCP:NREP 1 RP:SCP:REP 70->307|2ar0A1|5e-13|13.2|219/485|c.66.1.45| HM:SCP:REP 139->374|1o9gA_|1e-40|32.0|200/0|c.66.1.29|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 593 OP:NHOMOORG 582 OP:PATTERN ---111-----------------1-------1---11-----------------111-111---11-- --------------------------------------------------------------------------------11------1111-111---111111111-1--------------1---------------------111-111--1111111111-1--11111111111111---------1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111-1111-11-1-1-1-1--------------------------------------------------------------1111-----11---------------------------------------------------11-1111111111111111111111111111111111111111111111111111111111111111111122211-11--1----11111112122222111---------------------------111111111111111111111111111111--1-1--1--11111111111111111111-1111111111111111111111111111111111111111111111111111-111111111111--11-----11111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111--1-111111--------1---------------------------1--11-1------ -----1------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------111111-111--1--2211---1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 362 STR:RPRED 96.5 SQ:SECSTR ##EEEEEEccTTcHHHHHHHHHHTTc#ccEEETTEEEEEEcHHHHHHHHHHcHHHHHHTccTTcHHHHHHHHHHHHHHHHHHHHHTTcccEEEEEEEccccccccHHHHHHHHHHHHHHHcTTcHTTcEEccccccEEEEEEEETTEEEEEEEEcccTTHHHHHHTccccccccHHHHHHHHHHHcccTTccEEETTcTTTHHHHHHHHHHHTTTTTTTcccEEEEEETccHHHHHHHHHTccEccHHHHTcEEEEEccHHHHHHHHHHHTTTccccGGGTccEEEccTTcHHHEEEEEEccccTTccccccccccccccHHHHHHHEEEEEEEEEEEEHHHHHccTHHHHHHHHHHHEEEEEEE########## DISOP:02AL 374-375| PSIPRED ccEEEEEEccccHHHHHHHHHHHccccccEEEccEEEEEEcHHHHHHHHHHHccHHHEEEEEEEEccccHHHHHHHHHHcccHHccccccEEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEEEEccEEEEEEEcccccHHHcccccccccccccHHHHHHHHHHcccccccEEEEccccccHHHHHHHHHHHHccccccHHHHHHHcccccHHHHHHHHHHHHHHHcccccEEEEEEccHHHHHHHHHHHHHcccccEEEEEEccHHHcccccccEEEEEccccccccccHHHHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHccccccEEEEEEcccEEEHHHHHHHHHcc //