[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE1854
DDBJ      :CPE1854      conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  765/915 : Eukaryota  151/199 : Viruses  0/175   --->[See Alignment]
c.1.6
:219 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->214 1w8gA PDBj 7e-24 39.3 %
:RPS:PDB   3->213 3cpgA PDBj 1e-32 28.0 %
:RPS:SCOP  3->214 1b54A  c.1.6.2 * 2e-28 29.4 %
:HMM:SCOP  1->214 1ct5A_ c.1.6.2 * 3e-75 47.4 %
:RPS:PFM   3->216 PF01168 * Ala_racemase_N 5e-16 29.6 %
:HMM:PFM   3->216 PF01168 * Ala_racemase_N 7.6e-42 28.9 190/214  
:BLT:SWISS 19->218 Y274_AQUAE 4e-37 43.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81560.1 GT:GENE CPE1854 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2123895..2124554) GB:FROM 2123895 GB:TO 2124554 GB:DIRECTION - GB:GENE CPE1854 GB:PRODUCT conserved hypothetical protein GB:NOTE 219 aa, similar to pir:B72217 conserved hypothetical protein from Thermotoga maritima (strain MSB8) (229 aa); 41.7% identity in 211 aa overlap GB:PROTEIN_ID BAB81560.1 LENGTH 219 SQ:AASEQ MDIKENLTKFTEKIPSNVQLIAVSKTRTIEEMEEAYEFGIRKFGENKVQEIIRKFDEFHQDVEWHLIGHLQTNKVKYIVDKVHLIQSLDSIKLLKEIEKVYGKHNKIANTLIQVNIGREEQKYGILEEELDELIEAIEACNNVNVLGIMTIIPKGTEEECRKYFSKTHKLFCELKEKKFKNIKMDILSMGMSGDYEIATEEGSNMVRIGQGIFGKRLYK GT:EXON 1|1-219:0| BL:SWS:NREP 1 BL:SWS:REP 19->218|Y274_AQUAE|4e-37|43.4|198/228| SEG 125->139|ileeeldelieaiea| SEG 169->180|klfcelkekkfk| BL:PDB:NREP 1 BL:PDB:REP 2->214|1w8gA|7e-24|39.3|211/226| RP:PDB:NREP 1 RP:PDB:REP 3->213|3cpgA|1e-32|28.0|207/247| RP:PFM:NREP 1 RP:PFM:REP 3->216|PF01168|5e-16|29.6|203/211|Ala_racemase_N| HM:PFM:NREP 1 HM:PFM:REP 3->216|PF01168|7.6e-42|28.9|190/214|Ala_racemase_N| RP:SCP:NREP 1 RP:SCP:REP 3->214|1b54A|2e-28|29.4|204/230|c.1.6.2| HM:SCP:REP 1->214|1ct5A_|3e-75|47.4|211/0|c.1.6.2|1/1|PLP-binding barrel| OP:NHOMO 985 OP:NHOMOORG 920 OP:PATTERN -------------------------------------------------1111--------------- 111-11111111-1111----1--11----------1111----11-1-11---------1--11111-11111111-111111111111111111---11211121211--------------1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111------------11--------1111111111111111111111111111111111111111111111111111111111111121111111111-11111111111111111111-11111111111111111111112121111111111112-111111111111111111111111111111111111111111111111--11112-----------------------------111111222121111111111111111111111111112-1111111112-1111121211111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111--1111111-11111211211111111111-11111111111111111111112211111111111111111111111111111111111111111--111111111111111111111111111111111111111111111111111111111111111111111111111111111111221111111111111111111111--------1-1-------------------------1111111111111 --11111-21111111111-1111------------1---------11--11-1111-1111111111-1111111111111111111-121111111111-1111-12-12-11121-1-11-21111241-1111--131111-1---11-2-111134212111112111311-11F1111121111311111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 218 STR:RPRED 99.5 SQ:SECSTR #cHHHHHHHHHHHHHHccEEEEEcTTccHHHHHHHHHTTccEEEEccHHHHHHHHHHHcEEEcEEEcccccGGGHHHHTTTccEEEEEccHHHHHHHHHHHHHHTccEEEEEEccccccTTcccccGGGHHHHHHHHHTcTTEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHccTTcTTccEEEcTTTHHHHHTTccEEEEcTTTccccTTT DISOP:02AL 218-220| PSIPRED ccHHHHHHHHHHHcccccEEEEEEccccHHHHHHHHHccccEEEccHHHHHHHHHHHcccccEEEEEccccHHHHHHHHccccEEEEEccHHHHHHHHHHHHHcccccEEEEEEEcccccccccccHHHHHHHHHHHHHccccEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHccccccccEEEccccHHHHHHHHccccEEEEcHHHccccccc //