[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE1858
DDBJ      :CPE1858      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  29/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:248 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   70->109 PF08478 * POTRA_1 2e-04 35.0 %
:HMM:PFM   42->109 PF08478 * POTRA_1 1.7e-18 32.4 68/69  
:HMM:PFM   11->37 PF09889 * DUF2116 0.0004 40.7 27/59  
:BLT:SWISS 69->222 FTSQ_CORGL 4e-05 28.7 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81564.1 GT:GENE CPE1858 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2126479..2127225) GB:FROM 2126479 GB:TO 2127225 GB:DIRECTION - GB:GENE CPE1858 GB:PRODUCT hypothetical protein GB:NOTE 248 aa, no significant homology Putative N-terminal signal sequence was found by PSORT GB:PROTEIN_ID BAB81564.1 LENGTH 248 SQ:AASEQ MSTNINEYIQKKKRKKTRKKIILVSIILIVILGLILIKTPYFNIKKVNVNNNNVITKESVIGENDILNQNIFLLNTSALKKKILSNPYVKSVKISRKLPDQLSINVVERNATFIVNEGTDFYVLNENLVIMEKKNSEEGLQLPTVTGLTVENRFLGEPMSTDKDKVEVLKEIGEALNKSKIKVNSVDISNLNNIVINKGEVQILLGNSDKLSDKLTKMVNILNDPAGNFEKGYINISFNGNPVIYKEK GT:EXON 1|1-248:0| BL:SWS:NREP 1 BL:SWS:REP 69->222|FTSQ_CORGL|4e-05|28.7|136/222| TM:NTM 1 TM:REGION 21->42| SEG 11->37|kkkrkktrkkiilvsiilivilglili| SEG 43->55|nikkvnvnnnnvi| RP:PFM:NREP 1 RP:PFM:REP 70->109|PF08478|2e-04|35.0|40/69|POTRA_1| HM:PFM:NREP 2 HM:PFM:REP 42->109|PF08478|1.7e-18|32.4|68/69|POTRA_1| HM:PFM:REP 11->37|PF09889|0.0004|40.7|27/59|DUF2116| OP:NHOMO 29 OP:NHOMOORG 29 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------11111111111111-1111111-1---------11---1-1-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 247-248| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEccccccHHHHHHHHccccccEEEEcHHHHHHHHHHcccEEEEEEEEEEccEEEEEEEEEEEEEEEEccccEEEEccccEEEccccccccccccEEEcccccccccccccccHHHHHHHHHHHHHHHHHHcccEEEEEEcccEEEEEEccccEEEEcccccHHHHHHHHHHHHHHHcccccEEEEEEEccccccccccc //