[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE1872
DDBJ      :CPE1872      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  19/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:144 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   84->136 PF00601 * Flu_NS2 0.00026 18.9 53/94  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81578.1 GT:GENE CPE1872 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2142447..2142881) GB:FROM 2142447 GB:TO 2142881 GB:DIRECTION - GB:GENE CPE1872 GB:PRODUCT hypothetical protein GB:NOTE 144 aa, no significant homology GB:PROTEIN_ID BAB81578.1 LENGTH 144 SQ:AASEQ MSFNTFAKEKLSQLLFLEIDGDGFVKSLGKDPKEVNINEVYIPIDPKHLSQDVKSGYKLESLPINYLVEGMFFALGGDKDFKFNKEYKKLIPLIEDAIPCVKKIVADKVKEENMVEAFMLLKGLTEISDETEVYENLLLILSNL GT:EXON 1|1-144:0| HM:PFM:NREP 1 HM:PFM:REP 84->136|PF00601|0.00026|18.9|53/94|Flu_NS2| OP:NHOMO 19 OP:NHOMOORG 19 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111--111111-1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6| PSIPRED ccHHHHHHHHHHHHHHEEEccccEEHHcccccEEEEccEEEccccHHHHHHHHHcccccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHEEEEccHHHHHHHHHHHccc //