[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE1920
DDBJ      :CPE1920      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  23/915 : Eukaryota  11/199 : Viruses  0/175   --->[See Alignment]
a.118.8
:116 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->97 1na0A PDBj 2e-13 36.2 %
:RPS:PDB   4->103 2cg3A PDBj 2e-12 6.0 %
:RPS:SCOP  6->110 1kt0A1  a.118.8.1 * 5e-10 22.9 %
:HMM:SCOP  4->116 1kt1A1 a.118.8.1 * 1.5e-20 34.5 %
:RPS:PFM   6->89 PF10300 * IML2 6e-04 31.0 %
:HMM:PFM   5->30 PF00515 * TPR_1 2.6e-07 38.5 26/34  
:HMM:PFM   37->66 PF00515 * TPR_1 3.8e-11 50.0 30/34  
:HMM:PFM   68->93 PF00515 * TPR_1 6.8e-05 26.9 26/34  
:BLT:SWISS 6->104 SPAG1_HUMAN 4e-11 32.3 %
:REPEAT 2|14->44|48->77

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81626.1 GT:GENE CPE1920 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 2202293..2202643 GB:FROM 2202293 GB:TO 2202643 GB:DIRECTION + GB:GENE CPE1920 GB:PRODUCT hypothetical protein GB:NOTE 116 aa, no significant homology GB:PROTEIN_ID BAB81626.1 LENGTH 116 SQ:AASEQ MSNFSKGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQDSKYFFNLAYCYSMINNNSKALRYFNLAWALDNADIDCEKAISLILSKISK GT:EXON 1|1-116:0| BL:SWS:NREP 1 BL:SWS:REP 6->104|SPAG1_HUMAN|4e-11|32.3|99/926| NREPEAT 1 REPEAT 2|14->44|48->77| BL:PDB:NREP 1 BL:PDB:REP 4->97|1na0A|2e-13|36.2|94/119| RP:PDB:NREP 1 RP:PDB:REP 4->103|2cg3A|2e-12|6.0|100/617| RP:PFM:NREP 1 RP:PFM:REP 6->89|PF10300|6e-04|31.0|84/458|IML2| HM:PFM:NREP 3 HM:PFM:REP 5->30|PF00515|2.6e-07|38.5|26/34|TPR_1| HM:PFM:REP 37->66|PF00515|3.8e-11|50.0|30/34|TPR_1| HM:PFM:REP 68->93|PF00515|6.8e-05|26.9|26/34|TPR_1| RP:SCP:NREP 1 RP:SCP:REP 6->110|1kt0A1|5e-10|22.9|105/155|a.118.8.1| HM:SCP:REP 4->116|1kt1A1|1.5e-20|34.5|113/168|a.118.8.1|1/1|TPR-like| OP:NHOMO 39 OP:NHOMOORG 35 OP:PATTERN -------------------------------------1------------------------------ --------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------111111111121--111111-1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------- --------------1--------------------------------------------------------1---------------------------------------1---1------------1222-11----------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 116 STR:RPRED 100.0 SQ:SECSTR EEEHHHHHHHHHTTcHHHHHHHHHHHHHHcTTcHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccccHHHHHHcHHHHHHHHHHHccHHHHTTcccccccHHHHHcH DISOP:02AL 116-117| PSIPRED cHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcc //