[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE1928
DDBJ      :CPE1928      probable dipeptidase
Swiss-Prot:             

Homologs  Archaea  26/68 : Bacteria  320/915 : Eukaryota  134/199 : Viruses  0/175   --->[See Alignment]
c.1.9
:328 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   91->301 3fdgB PDBj 4e-26 29.2 %
:RPS:PDB   16->280 3b40A PDBj 3e-25 20.2 %
:RPS:SCOP  2->326 1itqA  c.1.9.7 * 1e-80 24.7 %
:HMM:SCOP  13->327 1ituA_ c.1.9.7 * 3.4e-73 37.3 %
:RPS:PFM   16->282 PF01244 * Peptidase_M19 3e-47 39.8 %
:HMM:PFM   13->324 PF01244 * Peptidase_M19 1.5e-101 36.9 309/320  
:BLT:SWISS 73->326 YPQQ_KLEPN 1e-31 32.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81634.1 GT:GENE CPE1928 GT:PRODUCT probable dipeptidase GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2209361..2210347) GB:FROM 2209361 GB:TO 2210347 GB:DIRECTION - GB:GENE CPE1928 GB:PRODUCT probable dipeptidase GB:NOTE 328 aa, similar to pir:S20452 hypothetical protein X (fragment) from Klebsiella pneumoniae (271 aa); 34.3% identity in 254 aa overlap GB:PROTEIN_ID BAB81634.1 LENGTH 328 SQ:AASEQ MNFYRNLPIKIFMKFIDFHCDTASRMLQENKKLFRNDLKVDINKLREGEALAQFFALFINKECNSDTYSYCKEMLQNFKREINENSRDIVLCRNISDLEKAEKEDKIGAFITIEEGDAIKGNIEKLREFKEEGVSLITLTWNYINDLGYPNYEFKYKDKGLTKKGIEVVEEMNNLGMLIDVSHLSDGGFYDAIKYSKSPIIASHSNSRTKTNHSRNLTDHMIKELANSGGVTGINFCNAFLKEEWEEDLNLASIRNMVRHIKHIRNIGGIDVISLGSDFDGIENEVEIKDSSKMNLLLNALEIEGFKGEEIEKIYYKNAKRIIRDVLR GT:EXON 1|1-328:0| BL:SWS:NREP 1 BL:SWS:REP 73->326|YPQQ_KLEPN|1e-31|32.9|252/271| SEG 302->314|eiegfkgeeieki| BL:PDB:NREP 1 BL:PDB:REP 91->301|3fdgB|4e-26|29.2|209/348| RP:PDB:NREP 1 RP:PDB:REP 16->280|3b40A|3e-25|20.2|262/400| RP:PFM:NREP 1 RP:PFM:REP 16->282|PF01244|3e-47|39.8|261/312|Peptidase_M19| HM:PFM:NREP 1 HM:PFM:REP 13->324|PF01244|1.5e-101|36.9|309/320|Peptidase_M19| GO:PFM:NREP 4 GO:PFM GO:0006508|"GO:proteolysis"|PF01244|IPR008257| GO:PFM GO:0008235|"GO:metalloexopeptidase activity"|PF01244|IPR008257| GO:PFM GO:0008239|"GO:dipeptidyl-peptidase activity"|PF01244|IPR008257| GO:PFM GO:0016805|"GO:dipeptidase activity"|PF01244|IPR008257| RP:SCP:NREP 1 RP:SCP:REP 2->326|1itqA|1e-80|24.7|320/369|c.1.9.7| HM:SCP:REP 13->327|1ituA_|3.4e-73|37.3|308/0|c.1.9.7|1/1|Metallo-dependent hydrolases| OP:NHOMO 722 OP:NHOMOORG 480 OP:PATTERN 111---1111111111-21111--------------------------------11211111------ -33-1-------------------11-----1----12-1----1--1-11-----------2-1-1122----------11---------2-311-----1-121-321111111111111111-----------11111---121--1--------------------1------------2-111---11-1111111111111111111--11111112--11111142------------------------------------------------------------------------------------------13--1111111111113111111-11--1--1-111111111-1111--15--2112------------------11111111112---------122-2222111111231111-12411111341111111111111-1------------------------------12233--221-2111111111111211111-1111-1------1------1---1-----------------------------------------1---1111113-1------------------------------1--212111111111-111111-1112--1-----------111--1------------------------------111----------------------------------------------2-1--2------111---------------111-111-11112221241223232-322----------1--------1-1--1111111111-------1----------------1---------------------------1---1------ --------------1111111123132111111323222222211111232332112-1111-11-11----1-------1-----11-12111211113--1111-2-2A2321321222123532517G3-43512233223-1332131-222221122132624449--22--------------1--------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 317 STR:RPRED 96.6 SQ:SECSTR #######ccTTcccEEEEEEcccTTTTcTTccTccccccccHHHHHHHTEEEEcccccccTTHHHHHHHHHHHHHHHHHHHHHHcTTTEEEcccHHHHHHHHHTTcEEEEEEEEccGGGTTcTHHHHHHHHTTccEEEcccccccccccccGGGTccTTcccHHHHHHHHHHHHHTcEEEcTTccHHHHHHHHHHccccEEEEEEccTTTcccTTcccHHHHHHHHHTTcEEEEEccHHHHccccHHHHHHHHHHHcHHHHTTcccccccTTTcccccGGTccHHHHHHHHHHccccHHHHHHTTccHHHHHHHHTHHHHHHTT#### DISOP:02AL 328-329| PSIPRED ccHHHHHHHHHHccEEccccHHHHHHHHcccccccccccccHHHHHcccccEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHccccEEEEccHHHHHHHHHcccEEEEEEccccccccccHHHHHHHHHccccEEEEcccccccccccccccccccccccHHHHHHHHHHHHcccEEEEccccHHHHHHHHHHccccEEEEcccHHHcccccccccHHHHHHHHHcccEEEEEccHHHcccccccccccccHHHHHHHHHHHHHHHccccEEEcccccccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcc //