[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE1944
DDBJ      :CPE1944      conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  29/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:89 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   10->72 PF02699 * YajC 9e-09 38.1 %
:HMM:PFM   7->87 PF02699 * YajC 5.5e-30 41.2 80/83  
:BLT:SWISS 2->84 Y893_RICCN 3e-07 29.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81650.1 GT:GENE CPE1944 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2227570..2227839) GB:FROM 2227570 GB:TO 2227839 GB:DIRECTION - GB:GENE CPE1944 GB:PRODUCT conserved hypothetical protein GB:NOTE 89 aa, similar to pir:A81313 probable membrane protein Cj1094c from Campylobacter jejuni (strain NCTC 11168) (90 aa); 31% identity in 84 aa overlap. Putative N-terminal signal sequence was found by PSORT GB:PROTEIN_ID BAB81650.1 LENGTH 89 SQ:AASEQ MNFQQIATMVLPFILMFGVFYFLLILPEKKRKKKYDAMIDELKVNDKIITRGGIIGRIVKLKDDSVIIETTQDRTKIEFSKQGISSKID GT:EXON 1|1-89:0| BL:SWS:NREP 1 BL:SWS:REP 2->84|Y893_RICCN|3e-07|29.3|82/141| TM:NTM 1 TM:REGION 5->26| SEG 48->58|iitrggiigri| RP:PFM:NREP 1 RP:PFM:REP 10->72|PF02699|9e-09|38.1|63/82|YajC| HM:PFM:NREP 1 HM:PFM:REP 7->87|PF02699|5.5e-30|41.2|80/83|YajC| OP:NHOMO 29 OP:NHOMOORG 29 OP:PATTERN -------------------------------------------------------------------- -1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------11111111111-1111111-1--1------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 27-42| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccEEEEEccEEEEEEEEcccEEEEEEccccEEEEEEEHHHHHHcc //