[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE1949
DDBJ      :CPE1949      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:197 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 81->195 EF1A2_RHIRA 3e-04 28.8 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81655.1 GT:GENE CPE1949 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2231978..2232571) GB:FROM 2231978 GB:TO 2232571 GB:DIRECTION - GB:GENE CPE1949 GB:PRODUCT hypothetical protein GB:NOTE 197 aa, similar to pir:T44357 hypothetical protein from Clostridium histolyticum (204 aa); 30.3% identity in 165 aa overlap. Putative N-terminal signal sequence was found by PSORT GB:PROTEIN_ID BAB81655.1 LENGTH 197 SQ:AASEQ MNFNNIKNNDKIKNLIFILLGIFIFASSYMITYFYNSRKIQQTNMKVTEKKGELVLAENMDVIFTRRTLDDHVVVDYKTTIGEMVKNDEINGENMEELISAVEKDGYKLVSSTSGEIIFLNDMGILEAGKYYIGEKDGYIAIFKAGEDGRPFIEKPEDVSTKKIEDLPEVDRSKISNFEKKYDTREECEENITNYIS GT:EXON 1|1-197:0| BL:SWS:NREP 1 BL:SWS:REP 81->195|EF1A2_RHIRA|3e-04|28.8|111/458| TM:NTM 1 TM:REGION 13->35| SEG 2->25|nfnniknndkiknlifillgifif| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------1-1--11-111-1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 46-47| PSIPRED cccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEcccccEEHHHHHHHHccccEEEEEEEEccccEEEEcccHHHHHHHHHHcccccHHHHHHHHHHcccEEEEEccccEEEEEcccccccccEEEEEEccEEEEEEEccccccccccccHHHHHHHHHccHHHHHHHHccHHHHccHHHHHHHHHHHcc //