[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE1967
DDBJ      :CPE1967      conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  253/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.35.1b.82.1
:179 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->152 1y9qA PDBj 1e-04 26.1 %
:RPS:PDB   3->54 1d1lA PDBj 4e-11 11.5 %
:RPS:PDB   32->177 1e5sB PDBj 3e-20 13.3 %
:RPS:SCOP  4->177 1ey2A  b.82.1.4 * 3e-18 8.6 %
:HMM:SCOP  1->69 2b5aA1 a.35.1.3 * 4.7e-16 36.2 %
:HMM:SCOP  54->179 1sefA_ b.82.1.11 * 7.6e-32 32.5 %
:RPS:PFM   7->60 PF01381 * HTH_3 3e-08 42.6 %
:RPS:PFM   106->175 PF01050 * MannoseP_isomer 2e-04 27.1 %
:HMM:PFM   105->173 PF07883 * Cupin_2 8e-21 32.4 68/71  
:HMM:PFM   7->61 PF01381 * HTH_3 3.5e-15 38.2 55/55  
:BLT:SWISS 4->179 PUUR_SHIFL 2e-13 28.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81673.1 GT:GENE CPE1967 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 2256585..2257124 GB:FROM 2256585 GB:TO 2257124 GB:DIRECTION + GB:GENE CPE1967 GB:PRODUCT conserved hypothetical protein GB:NOTE 179 aa, similar to pir:E72348 conserved hypothetical protein from Thermotoga maritima (strain MSB8) (176 aa); 42.2% identity in 173 aa overlap GB:PROTEIN_ID BAB81673.1 LENGTH 179 SQ:AASEQ MEIGDKIRRLRVAKQLTQEELANRCELSKGFISQLENDLTSPSIATLIDILDILGTNLTEFFSEDTNEKIAFSKDDMFETENEELKYNLMWLVPNAQKNDMEPIMITLEPGGQYIEEEPHEGEEFGYVLSGAIYLHLGDKKVKVRKGESFYFKPKANHYISNAGKISAKVIWISTPPSF GT:EXON 1|1-179:0| BL:SWS:NREP 1 BL:SWS:REP 4->179|PUUR_SHIFL|2e-13|28.9|173/185| SEG 116->124|eeephegee| BL:PDB:NREP 1 BL:PDB:REP 2->152|1y9qA|1e-04|26.1|142/173| RP:PDB:NREP 2 RP:PDB:REP 3->54|1d1lA|4e-11|11.5|52/61| RP:PDB:REP 32->177|1e5sB|3e-20|13.3|143/243| RP:PFM:NREP 2 RP:PFM:REP 7->60|PF01381|3e-08|42.6|54/55|HTH_3| RP:PFM:REP 106->175|PF01050|2e-04|27.1|70/151|MannoseP_isomer| HM:PFM:NREP 2 HM:PFM:REP 105->173|PF07883|8e-21|32.4|68/71|Cupin_2| HM:PFM:REP 7->61|PF01381|3.5e-15|38.2|55/55|HTH_3| GO:PFM:NREP 3 GO:PFM GO:0043565|"GO:sequence-specific DNA binding"|PF01381|IPR001387| GO:PFM GO:0005976|"GO:polysaccharide metabolic process"|PF01050|IPR001538| GO:PFM GO:0016779|"GO:nucleotidyltransferase activity"|PF01050|IPR001538| RP:SCP:NREP 1 RP:SCP:REP 4->177|1ey2A|3e-18|8.6|174/419|b.82.1.4| HM:SCP:REP 1->69|2b5aA1|4.7e-16|36.2|69/0|a.35.1.3|1/1|lambda repressor-like DNA-binding domains| HM:SCP:REP 54->179|1sefA_|7.6e-32|32.5|126/0|b.82.1.11|1/1|RmlC-like cupins| OP:NHOMO 379 OP:NHOMOORG 259 OP:PATTERN --------------------------------1-1----111--------1----------------- 11-----------------------1------------21------------1-1-------------------------1---------11-1-----------1-1-----------------------------11-------------------------------------------------------11111111-111121------1-1-1-111111111122211111111111111111112---11-----11--11------------------------------------------------------111-3333333131132211111-1-11-1--22-1---111-----2--1----1-------41---1-----11111111111---3--1--121-4221224222422------21-11313------------1--1--------------------------------1-------1333413222211323333-2224--21--11----------6--1--1-11---------------111-1---------323-12222-------3---------------------------11----1-----------1------1------------------------111-1---11-11111--1111-111111-------------------------111111-1--1---------------------------1--------------------------11334311---22211---------------------------------------------11--------------1-------------------------1-11112111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 179 STR:RPRED 100.0 SQ:SECSTR HHHHHHHHHHHHHTTccHHHHHHTTTccHHHcccEEcccccccTTTHHHHHHHHHHccccccccEEEEEEEEccccTTGEEcGGcHHHHHHHHHccccTTccEEEEEEEEcEEEEEEccccccEEEEEccTTEEEEETTEEEcccTTccEEccccccEEEEEcccccccEEEEEccccc DISOP:02AL 109-119| PSIPRED ccHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHcccccccHHHHHHHHHHHcccEEEEccccccccEEEEccHHEEEEEcccccEEEEEEcccHHHHEEEEEEEccccccccccccccccEEEEEEEEEEEEEEccEEEEEccccEEEEcccccEEEEEcccccEEEEEEEccccc //