[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE2001
DDBJ      :CPE2001      conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  19/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:229 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   27->213 3cixA PDBj 4e-06 13.4 %
:BLT:SWISS 16->136 Y550_METJA 5e-07 32.8 %
:BLT:SWISS 119->212 FLGE_HELMU 6e-04 29.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81707.1 GT:GENE CPE2001 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2292691..2293380) GB:FROM 2292691 GB:TO 2293380 GB:DIRECTION - GB:GENE CPE2001 GB:PRODUCT conserved hypothetical protein GB:NOTE 229 aa, similar to N-terminal of pir:D69376 conserved hypothetical protein AF1012 from Archaeoglobus fulgidus (312 aa); 27.1% identity in 129 aa overlap GB:PROTEIN_ID BAB81707.1 LENGTH 229 SQ:AASEQ MDRYNVIDNKNNREIVLLKSFPCVWGKCAFCDYIEDNSKNTEEIIKLNKEVLSNVKGIYGVLEVINSGSVFELPKETLEEIKRIVVEKNIKKLFFEAHWCYRNRLKEIEEYFGVPIIFKTGIETFDDHFRNDILNKNARFNDVEEVKKYFKSICLMVGIKGQNKDMIKRDMDILLNNFKYGTVNIWTENTTSFKRDEELIKWFEKEYSFLKDNKTIEVLFENTDFGVGD GT:EXON 1|1-229:0| BL:SWS:NREP 2 BL:SWS:REP 16->136|Y550_METJA|5e-07|32.8|119/365| BL:SWS:REP 119->212|FLGE_HELMU|6e-04|29.2|89/100| RP:PDB:NREP 1 RP:PDB:REP 27->213|3cixA|4e-06|13.4|187/345| OP:NHOMO 19 OP:NHOMOORG 19 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1-1--1111----1--------------------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 187 STR:RPRED 81.7 SQ:SECSTR ##########################ccTTcTTcTTccccccccccHHHHHHHHHHHTTccEEEEEEcccGGGTTHHHHHHHHHHHTTccEEEEEcccccHHHHHHHHHTTccEEEcccccccHHHHHHHcTTccHHHHHHHHHHHHTTEEEEccEEccTTccHHHHHHHHHHHEccEEccccTTcTTTTcccccHHHHHHHHHHHHHHcTTc################ DISOP:02AL 1-2| PSIPRED cccccccccccEEEEEEEcccccEEEEEEEccccccccccHHHHHHHHHHHHHHccccccEEEEEEcccEEEccHHHHHHHHHHHHHcccEEEEEEEcHHHHHHHHHHHHHcccEEEEEEEEEcccHHHHHHHccccccHHHHHHHHHHHHHEEEEEccccHHHHHHHHHHHHHHHHHHHHEEEEEEcccEEEccHHEEEHHHHHHccccccccEEEEEEEcccccccc //