[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE2021
DDBJ      :CPE2021      conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  37/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:93 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   27->90 PF07873 * YabP 5e-07 32.8 %
:HMM:PFM   26->91 PF07873 * YabP 6.6e-23 39.4 66/66  
:BLT:SWISS 1->93 YQFC_BACSU 3e-11 31.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81727.1 GT:GENE CPE2021 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2314283..2314564) GB:FROM 2314283 GB:TO 2314564 GB:DIRECTION - GB:GENE CPE2021 GB:PRODUCT conserved hypothetical protein GB:NOTE 93 aa, similar to sp:YQFC_BACSU HYPOTHETICAL 10.8 KDA PROTEIN IN RPSU-PHOH INTEREGENIC REGION from Bacillus subtili (93 aa); 30.1% identity in 93 aa overlap GB:PROTEIN_ID BAB81727.1 LENGTH 93 SQ:AASEQ MGDKLRQVTNRIAEELDLPKEIINGEPKIVVHGKSEIIIENHKGIEVFKENEIKINSNLGVIIIEGTNLEIRFIGTETIALTGRLKNLSFEEA GT:EXON 1|1-93:0| BL:SWS:NREP 1 BL:SWS:REP 1->93|YQFC_BACSU|3e-11|31.2|93/93| RP:PFM:NREP 1 RP:PFM:REP 27->90|PF07873|5e-07|32.8|64/66|YabP| HM:PFM:NREP 1 HM:PFM:REP 26->91|PF07873|6.6e-23|39.4|66/66|YabP| OP:NHOMO 37 OP:NHOMOORG 37 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------1-----------1----------------11------------------------------------------------------------------------------------------1--1111111111111-1111111-1----1----11-111--1111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8| PSIPRED cHHHHHHHHHHHHHHHcccHHHHHcccEEEEEEcEEEEEEEcEEEEEEcccEEEEEccccEEEEEEccEEEEEEccHHEEEEEEEEEEEEEEc //