[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE2023
DDBJ      :CPE2023      30S ribosomal protein S2
Swiss-Prot:RS21_CLOPS   RecName: Full=30S ribosomal protein S21;

Homologs  Archaea  0/68 : Bacteria  390/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:58 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->42 1vs5U PDBj 1e-11 66.7 %
:RPS:PDB   3->43 3bbnU PDBj 1e-07 36.6 %
:HMM:PFM   3->58 PF01165 * Ribosomal_S21 8.6e-29 58.9 56/57  
:BLT:SWISS 1->43 RS21_CLOPS 4e-20 100.0 %
:PROS 13->25|PS01181|RIBOSOMAL_S21
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81729.1 GT:GENE CPE2023 GT:PRODUCT 30S ribosomal protein S2 GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2315288..2315464) GB:FROM 2315288 GB:TO 2315464 GB:DIRECTION - GB:GENE CPE2023 GB:PRODUCT 30S ribosomal protein S2 GB:NOTE 58 aa, similar to sp:RS21_MYXXA 30S RIBOSOMAL PROTEIN S21 from Myxococcus xanthus (64 aa); 69.8% identity in 43 aa overlap GB:PROTEIN_ID BAB81729.1 LENGTH 58 SQ:AASEQ MSEIRVKENESLEQALRRFKRQCARAGVLSEVRKREHYEKPSVKRKKKSEAARKRKFK GT:EXON 1|1-58:0| SW:ID RS21_CLOPS SW:DE RecName: Full=30S ribosomal protein S21; SW:GN Name=rpsU; OrderedLocusNames=CPR_1995; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->43|RS21_CLOPS|4e-20|100.0|43/58| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 13->25|PS01181|RIBOSOMAL_S21|PDOC00909| SEG 44->57|krkkkseaarkrkf| BL:PDB:NREP 1 BL:PDB:REP 4->42|1vs5U|1e-11|66.7|39/51| RP:PDB:NREP 1 RP:PDB:REP 3->43|3bbnU|1e-07|36.6|41/53| HM:PFM:NREP 1 HM:PFM:REP 3->58|PF01165|8.6e-29|58.9|56/57|Ribosomal_S21| OP:NHOMO 392 OP:NHOMOORG 390 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------1-----11--------1111----------------------11111111-11111111111111111111-111111111111-111111111111111111111-11111111--1111-11---111111111111111111111111111111111111-1111111111111121111111111111111111-111111-11111-1-1111111---11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------1111111-111111----------------------------111111111111111111111111111111--1-111111111111-111111111111-11-111111111111111111111111111111111111111111111111111111111111111111111-----1111-111111111111111111111-1111111-1-----11-------111111111111--1111111111111111111111111111---11----------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 41 STR:RPRED 70.7 SQ:SECSTR ##ccccccccccccccccccTTTTTTHHHHcccccccTTTTTT############### DISOP:02AL 44-58| PSIPRED ccEEEEcccccHHHHHHHHHHHHHHccHHHHHHHHHHccccHHHHHHHHHHHHHHHcc //