[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE2027
DDBJ      :CPE2027      ribosomal protein L11 methyltransferase
Swiss-Prot:PRMA_CLOPS   RecName: Full=Ribosomal protein L11 methyltransferase;         Short=L11 Mtase;         EC=2.1.1.-;

Homologs  Archaea  13/68 : Bacteria  695/915 : Eukaryota  26/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:313 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   121->305 3grzB PDBj 2e-33 37.7 %
:RPS:PDB   67->311 3cjrA PDBj 6e-39 28.8 %
:RPS:SCOP  7->311 1ufkA  c.66.1.39 * 1e-27 29.5 %
:HMM:SCOP  51->311 1ufkA_ c.66.1.39 * 8.1e-51 29.2 %
:RPS:PFM   67->311 PF06325 * PrmA 2e-58 47.9 %
:HMM:PFM   4->312 PF06325 * PrmA 3.4e-108 46.9 294/295  
:BLT:SWISS 1->313 PRMA_CLOPS 0.0 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81733.1 GT:GENE CPE2027 GT:PRODUCT ribosomal protein L11 methyltransferase GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2318076..2319017) GB:FROM 2318076 GB:TO 2319017 GB:DIRECTION - GB:GENE CPE2027 GB:PRODUCT ribosomal protein L11 methyltransferase GB:NOTE 313 aa, similar to pir:S41759 ribosomal protein L11 methyltransferase (EC 2.1.1.-) from Clostridium acetobutylicum (298 aa); 55.9% identity in 299 aa overlap. 1 putative transmembrane region was found by PSORT GB:PROTEIN_ID BAB81733.1 LENGTH 313 SQ:AASEQ MEGTWIEVRVITKSEALEPISGIFYGLDCKGVAIEDPNDILGREQGPLTWDFADINILEHKGKVAVVKGYFSEEDNIDDVIAYVKERVEELKESGLDVGEGTVEAEKMFEEDWANNWKKYYKPIKIGEKIVIKPIWEEYEPTGEEMVVELDPGMAFGTGDHETTRMCVQALDKYVKADTTVFDIGTGSGILALVASKLGAKHVVGVDLDPVAVDSAKENISFNNVDNIEVLYGNLLDVVDGKADIVVANIIAEIICILVDDVKKALNKDGIFITSGIIHERRQMVIDKLEQEGFEVMEVNKDGEWNCIVAKLK GT:EXON 1|1-313:0| SW:ID PRMA_CLOPS SW:DE RecName: Full=Ribosomal protein L11 methyltransferase; Short=L11 Mtase; EC=2.1.1.-; SW:GN Name=prmA; OrderedLocusNames=CPR_1999; SW:KW Complete proteome; Cytoplasm; Methyltransferase; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->313|PRMA_CLOPS|0.0|100.0|313/313| GO:SWS:NREP 3 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0008168|"GO:methyltransferase activity"|Methyltransferase| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| BL:PDB:NREP 1 BL:PDB:REP 121->305|3grzB|2e-33|37.7|183/193| RP:PDB:NREP 1 RP:PDB:REP 67->311|3cjrA|6e-39|28.8|236/249| RP:PFM:NREP 1 RP:PFM:REP 67->311|PF06325|2e-58|47.9|234/245|PrmA| HM:PFM:NREP 1 HM:PFM:REP 4->312|PF06325|3.4e-108|46.9|294/295|PrmA| GO:PFM:NREP 3 GO:PFM GO:0005737|"GO:cytoplasm"|PF06325|IPR010456| GO:PFM GO:0006479|"GO:protein amino acid methylation"|PF06325|IPR010456| GO:PFM GO:0008276|"GO:protein methyltransferase activity"|PF06325|IPR010456| RP:SCP:NREP 1 RP:SCP:REP 7->311|1ufkA|1e-27|29.5|244/248|c.66.1.39| HM:SCP:REP 51->311|1ufkA_|8.1e-51|29.2|253/0|c.66.1.39|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 761 OP:NHOMOORG 734 OP:PATTERN --------------------------------11-1112212---------------1111------- --1--------------------------------------------------------------------------------111111111-111---111111111-1---------------1111111111111111---1111121111111111111111122111111111111111111111-111111111111111111111111111211-1111111112111111111111111111111111111111111111111-111-1111111111111111111111111111111111111121111111111111111111121211111222111-111112111111111111111111-----11-11-11111111111111111111-111-11-11-11111--1111111111111111111----1111111111111111111--------------11----------------111111-111111111111111111111111111111111111111111111111111111111111111111113331111111111111112211111111211111111111111111111111111111111111111111111111111111111111--11111------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111--11-----111111111111111111111111111111111111111111111111111111111111111111111111111111111111111------111111--------------------------------------1111111111-11 -----------------------111-------------------------------1-------------1-------------1-----------------------------------------------------------------------------------1---1-111121111111-2-1121----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 310 STR:RPRED 99.0 SQ:SECSTR ###TEEEEEEEccHHHHGGGHHHHHHTTccEEEEETTEGEEEEEccccccTEEEEEEEEEETTEEEEEccTTTcGGGHHTGGGHHHHHHHTccEEEcccEEEEEEccccccTTccEEEcccHHHHHccccEEETTTcccccccccEEEEccccccccccccHHHHHHHHHHHHHccTTcEEEEEccTTcHHHHHHHHTTccEEEEEEccGGGHHHHHHHHHHHTcccEEEEccHHHHGGGccEEEEEEEccHHHHHHHHHHHHHHEEEEEEEEEEEEEGGGHHHHHHHHHHTTcEEEEEEEETTEEEEEEEcc DISOP:02AL 313-314| PSIPRED ccccEEEEEEEEcHHHHHHHHHHHHHccccEEEEEcccccccccccccccccccccccccccccEEEEEEccccccHHHHHHHHHHHHHHHHHHcccccccEEEEEEcccHHHHHHHHHcccEEEccccEEEccccccccccccEEEEEEcccccccccccHHHHHHHHHHHHccccccEEEEEcccHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHcccccEEEEEccHHHcccccEEEEEEcccHHHHHHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHHcccEEEEEEEEccEEEEEEEEc //