[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE2028
DDBJ      :CPE2028      probable transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  9/68 : Bacteria  212/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:118 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->116 3by6E PDBj 8e-14 30.4 %
:RPS:PDB   6->116 3by6D PDBj 2e-16 30.6 %
:RPS:SCOP  9->79 1e2xA1  a.4.5.6 * 2e-14 21.1 %
:HMM:SCOP  2->110 1v4rA1 a.4.5.6 * 7.4e-17 32.0 %
:RPS:PFM   14->65 PF00392 * GntR 5e-07 46.2 %
:HMM:PFM   12->72 PF00392 * GntR 5.4e-16 36.1 61/64  
:BLT:SWISS 9->115 YHCF_BACSU 8e-25 48.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81734.1 GT:GENE CPE2028 GT:PRODUCT probable transcriptional regulator GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2319244..2319600) GB:FROM 2319244 GB:TO 2319600 GB:DIRECTION - GB:GENE CPE2028 GB:PRODUCT probable transcriptional regulator GB:NOTE 118 aa, similar to gpu:AP001516_76 transcriptional regulator (GntR family) from Bacillus halodurans (123 aa); 52.5% identity in 118 aa overlap GntR family GB:PROTEIN_ID BAB81734.1 LENGTH 118 SQ:AASEQ MFFEVNDREPIYLQIIRHIKQSLVIGSLKPGDHIPSRRELAEMLKVNPNTVQRAYRDMETMGLIETIRNKPSTITEDEEILKNIRKELVEDALDGFIESMKAINLTKEEVLEIIKERY GT:EXON 1|1-118:0| BL:SWS:NREP 1 BL:SWS:REP 9->115|YHCF_BACSU|8e-25|48.6|107/121| BL:PDB:NREP 1 BL:PDB:REP 5->116|3by6E|8e-14|30.4|112/124| RP:PDB:NREP 1 RP:PDB:REP 6->116|3by6D|2e-16|30.6|111/121| RP:PFM:NREP 1 RP:PFM:REP 14->65|PF00392|5e-07|46.2|52/64|GntR| HM:PFM:NREP 1 HM:PFM:REP 12->72|PF00392|5.4e-16|36.1|61/64|GntR| GO:PFM:NREP 3 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00392|IPR000524| GO:PFM GO:0005622|"GO:intracellular"|PF00392|IPR000524| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00392|IPR000524| RP:SCP:NREP 1 RP:SCP:REP 9->79|1e2xA1|2e-14|21.1|71/73|a.4.5.6| HM:SCP:REP 2->110|1v4rA1|7.4e-17|32.0|100/0|a.4.5.6|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 413 OP:NHOMOORG 221 OP:PATTERN -------11111111------------------------------1---------------------- 1-1----------------------------------2-1-1-1-1------------------11-123-1----11--31------------11-----------1-1----------------------------------1--------------------------------------1----11-21266666556466654534332266521221213333231311111111111111111111-132222111133--12112111---1111111-11111111111111111111111111-11111111123-1444433333332333232225131-42--221213-3-1---1---1-3--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-1----111111-1--------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------11------------------------------1---------------------------21112-11----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 116 STR:RPRED 98.3 SQ:SECSTR HcccccccccHHHHHHHHHHHHHHTTcccTTcEEccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEETTTEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHTTccHHHHHHHHHH## DISOP:02AL 1-7, 80-89| PSIPRED ccccccccccHHHHHHHHHHHHHHccccccccccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEccccEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHc //