[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE2029
DDBJ      :CPE2029      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
e.29.1
:392 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  23->271 1i3qB  e.29.1.1 * 9e-05 12.1 %
:HMM:PFM   126->168 PF03347 * TDH 0.00089 30.2 43/166  
:BLT:SWISS 33->157 PEX27_YEAST 5e-04 28.4 %
:BLT:SWISS 130->238 APLP_MANSE 3e-04 32.4 %
:BLT:SWISS 215->341 MOCOS_CAEEL 4e-04 24.2 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81735.1 GT:GENE CPE2029 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2319602..2320780) GB:FROM 2319602 GB:TO 2320780 GB:DIRECTION - GB:GENE CPE2029 GB:PRODUCT hypothetical protein GB:NOTE 392 aa, partially similar to gp:PFMAL3P2_16 PFC0235w gene product from Plasmodium falciparum (1213 aa); 25.2% identity in 313 aa overlap. Putative N-terminal signal sequence was found by PSORT GB:PROTEIN_ID BAB81735.1 LENGTH 392 SQ:AASEQ MKKRVPLVLTIIFLSAFIIFSGIFIYINCSPMKFKDIYGSRSELGDVDLVFYKDRDIFEEEVTVGAETINRKNIINERRFDGIDVLKDKKFFRGIYPTRNTFFEDDDVMVDVTNIYGNGIQKLEVRFKDKKTNTYETFKVKVDEYIRNNNIDKVTYKDGKINILFSMNYEENNIVFGEINLSDKKFNIVDIINLDEELHLNEEFSHINSIPQEFGTLLNAEEDTVYYKLNELDKTDKRGIYSDESIIELNVNTREIKRYNPDDKIRNEIKESSFDPNGKGGTMFEAYGEIYITQTSDEKTSVLVFDTKTKEFKFYKDIVENERLKRYGVEVRDLGKFIIVGNKVIANFVNVRDDGFVSGAYLSVIDIPSKNPVYIGELECGYLSDIKITGGK GT:EXON 1|1-392:0| BL:SWS:NREP 3 BL:SWS:REP 33->157|PEX27_YEAST|5e-04|28.4|116/376| BL:SWS:REP 130->238|APLP_MANSE|3e-04|32.4|102/3305| BL:SWS:REP 215->341|MOCOS_CAEEL|4e-04|24.2|124/709| TM:NTM 1 TM:REGION 7->29| HM:PFM:NREP 1 HM:PFM:REP 126->168|PF03347|0.00089|30.2|43/166|TDH| RP:SCP:NREP 1 RP:SCP:REP 23->271|1i3qB|9e-05|12.1|231/1083|e.29.1.1| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 266-277| PSIPRED cccccHHHHHHHHHHHHHHHccEEEEEEccccEEHHHcccccccccEEEEEEccccccHHHHHHcHHHccHHHccccccccccHHHcccHHHcccccccccccccccEEEEEEEcccccEEEEEEEEEccccccEEEEEEEEHHHHHcccccEEEEcccEEEEEEEEccccccEEEEEEEccccEEEEEEEEEccccccccHHHHHHHHHHHHHHHHccccccEEEEEEccccccccccccccccEEEEEccHHHHccccccHHHHHHHHHcccccccccccEEEEEcEEEEEEcccccEEEEEEEccccHHHHHHHHHcccHHHHHcccHHHcccEEEEccHHHHHHHccccccEEccEEEEEEEccccccEEEEEEcccEEEEEEEEccc //