[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE2037
DDBJ      :CPE2037      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.53.1
:89 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   2->75 1dfuP PDBj 2e-10 25.7 %
:RPS:SCOP  2->75 1dfuP  b.53.1.1 * 2e-10 25.7 %
:HMM:SCOP  2->89 1feuA_ b.53.1.1 * 1.7e-06 25.6 %
:HMM:PFM   2->84 PF01386 * Ribosomal_L25p 1.6e-13 30.1 83/88  
:BLT:SWISS 2->89 RL25_BACP2 5e-08 30.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81743.1 GT:GENE CPE2037 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2328948..2329217) GB:FROM 2328948 GB:TO 2329217 GB:DIRECTION - GB:GENE CPE2037 GB:PRODUCT hypothetical protein GB:NOTE 89 aa, no significant homology GB:PROTEIN_ID BAB81743.1 LENGTH 89 SQ:AASEQ MLNANKRDVKIKCRKFRNNGKATGVINRKNGDNISISVKISDLDKFLAKHGDHSDLEINLEGEVINTSIIEVQRDLLVHNAININLREI GT:EXON 1|1-89:0| BL:SWS:NREP 1 BL:SWS:REP 2->89|RL25_BACP2|5e-08|30.7|88/208| RP:PDB:NREP 1 RP:PDB:REP 2->75|1dfuP|2e-10|25.7|74/94| HM:PFM:NREP 1 HM:PFM:REP 2->84|PF01386|1.6e-13|30.1|83/88|Ribosomal_L25p| RP:SCP:NREP 1 RP:SCP:REP 2->75|1dfuP|2e-10|25.7|74/94|b.53.1.1| HM:SCP:REP 2->89|1feuA_|1.7e-06|25.6|86/185|b.53.1.1|1/1|Ribosomal protein L25-like| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 74 STR:RPRED 83.1 SQ:SECSTR #EEcEEcccccHHHHHHHTTEEEEEEEccccccEEEEEEHHHHHHHTTcGGGGTccEEEETTEEccEEEEEEEEc############## DISOP:02AL 1-9| PSIPRED ccccccccEEEEEEEEcccccEEEEEEcccccEEEEEEEEcHHHHHHHcccccccEEEEEcccEEcHHHHHHHHHHHEEEEEEEEEEEc //