[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE2039
DDBJ      :CPE2039      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:120 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   3->25 PF04070 * DUF378 0.00084 30.4 23/62  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81745.1 GT:GENE CPE2039 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2331328..2331690) GB:FROM 2331328 GB:TO 2331690 GB:DIRECTION - GB:GENE CPE2039 GB:PRODUCT hypothetical protein GB:NOTE 120 aa, no significant homology Putative N-terminal signal sequence was found by PSORT GB:PROTEIN_ID BAB81745.1 LENGTH 120 SQ:AASEQ MKKFMTILTLAIIVFSIISWGLIGVNIENTEAFNNQNYELSEKVDYDRIKEETGMDLTIFSEDNSPVKIYENKDEVYLVFKEHTLNLSKGLFGNILIGTFNLVNKLINDINQFIGNYIIM GT:EXON 1|1-120:0| TM:NTM 1 TM:REGION 5->27| HM:PFM:NREP 1 HM:PFM:REP 3->25|PF04070|0.00084|30.4|23/62|DUF378| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED cHHHHHHHHHHHHHHHHHHccEEEEEEcccccccccccEEcccccHHHHHHHcccEEEEEEcccccEEEEEccccEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHEEcc //