[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE2056
DDBJ      :CPE2056      conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  32/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.108.1
:168 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   50->126 1l7pB PDBj 1e-04 28.6 %
:RPS:SCOP  15->92 1cqzB1  c.108.1.2 * 6e-04 10.3 %
:HMM:SCOP  29->156 2cn1A1 c.108.1.21 * 1.1e-12 17.2 %
:HMM:PFM   8->53 PF04091 * Sec15 0.00044 26.1 46/310  
:HMM:PFM   42->111 PF00702 * Hydrolase 0.00055 19.3 57/192  
:BLT:SWISS 18->117 CICA_CAUCR 1e-06 23.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81762.1 GT:GENE CPE2056 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2349564..2350070) GB:FROM 2349564 GB:TO 2350070 GB:DIRECTION - GB:GENE CPE2056 GB:PRODUCT conserved hypothetical protein GB:NOTE 168 aa, similar to pir:H81344 hypothetical protein Cj0733 from Campylobacter jejuni (strain NCTC 11168) (212 aa); 28.2% identity in 177 aa overlap GB:PROTEIN_ID BAB81762.1 LENGTH 168 SQ:AASEQ MYGLKFYDEKKVKQSFLKFIDGVEENDLKILVKKYYDEVLSKIIYKDSIDMMKKLKSEGYKIYLISASPEFYLNELYNIKEVDVIIGTRFSFNEGKFERKMLGENCKGEEKVRRLKEYLQEHNIEVDYKNSYMFSDSLSDKPLLDLVGNAYLINYKKNNKNYKILNWK GT:EXON 1|1-168:0| BL:SWS:NREP 1 BL:SWS:REP 18->117|CICA_CAUCR|1e-06|23.0|100/222| SEG 135->146|sdslsdkplldl| SEG 151->166|ylinykknnknykiln| BL:PDB:NREP 1 BL:PDB:REP 50->126|1l7pB|1e-04|28.6|77/208| HM:PFM:NREP 2 HM:PFM:REP 8->53|PF04091|0.00044|26.1|46/310|Sec15| HM:PFM:REP 42->111|PF00702|0.00055|19.3|57/192|Hydrolase| RP:SCP:NREP 1 RP:SCP:REP 15->92|1cqzB1|6e-04|10.3|78/222|c.108.1.2| HM:SCP:REP 29->156|2cn1A1|1.1e-12|17.2|128/0|c.108.1.21|1/1|HAD-like| OP:NHOMO 33 OP:NHOMOORG 32 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111-111112--1------------------------1------------------------------------------------------------------------------------------------------------------------------------111111-----11--------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 77 STR:RPRED 45.8 SQ:SECSTR #################################################HHHHHHHHTTcEEEEEEEEEHHHHHHHHHHHTccEEEEEEEEEETTEEEcccccTTHHHHHHHHHHHTccGGGEEEE########################################## PSIPRED ccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHHHcccEEEEEEEEEEccEEEEEEEccccccHHHHHHHHHHHHHHcccccHHHEEEEEccccHHHHHHHccccEEEcccHHHccccccccc //