[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE2060
DDBJ      :CPE2060      probable glutamate gamma-aminobutyrate antiporter
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  181/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:472 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   73->307 3giaA PDBj 5e-06 28.2 %
:RPS:PFM   46->317 PF00324 * AA_permease 3e-06 26.6 %
:HMM:PFM   32->470 PF00324 * AA_permease 1.3e-14 19.2 422/479  
:BLT:SWISS 8->469 GADC_LACLA e-149 56.6 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81766.1 GT:GENE CPE2060 GT:PRODUCT probable glutamate gamma-aminobutyrate antiporter GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2354027..2355445) GB:FROM 2354027 GB:TO 2355445 GB:DIRECTION - GB:GENE CPE2060 GB:PRODUCT probable glutamate gamma-aminobutyrate antiporter GB:NOTE 472 aa, similar to gp:AF309077_1 glutamate:gamma-aminobutyrate antiporter from Listeria monocytogenes (501 aa); 68.8% identity in 464 aa overlap. Putative N-terminal signal sequence and 11 putative transmembrane regions were found by PSORT. GB:PROTEIN_ID BAB81766.1 LENGTH 472 SQ:AASEQ MPSKSSANAKTLTLFGFFAMTASMVMTVYEYPTFATSGFHLVFFLIVGGLLWFLPVALCAAEMATVDGWEEGGIFAWVGNTLGERWGFAAIFFQWFQITVGFVTMIYFILGALSYVLNWPALNSNPLIKFIGVLIIFWGLTFSQFGGTKNTAKIAKAGFVFGVVVPAIILFILGIMYIAKGNPVHVDLSAHALIPDFTKVNTLVVFVSFILAYMGVEASASHVNKLENASKNYPLAMFILVVLAIVLNTVGGLTVAAVIPAEQLNLSAGVVQTFHQLVVVNLGESFDWITRIVALLLALGVMAEVSSWVVGPSEGMYAAAKKGLLPKKLTEVNNHEVPVPLVLVQGLVVTIWAAVLTFGGGGNNVSFLTAISLTVVIYLVGYLLFFIGYIILILKHGDLKRAYHVPGGKTFKMIVAIAGFAVSVFALVISFVPPSQLTGKSVSEYLTILSISFIVTVLIPFIIYALHDKWNK GT:EXON 1|1-472:0| BL:SWS:NREP 1 BL:SWS:REP 8->469|GADC_LACLA|e-149|56.6|461/503| TM:NTM 12 TM:REGION 9->31| TM:REGION 40->62| TM:REGION 99->121| TM:REGION 123->144| TM:REGION 155->177| TM:REGION 198->220| TM:REGION 242->264| TM:REGION 281->303| TM:REGION 337->359| TM:REGION 371->393| TM:REGION 412->434| TM:REGION 445->467| SEG 318->329|aaakkgllpkkl| SEG 337->349|vpvplvlvqglvv| SEG 381->394|gyllffigyiilil| BL:PDB:NREP 1 BL:PDB:REP 73->307|3giaA|5e-06|28.2|206/433| RP:PFM:NREP 1 RP:PFM:REP 46->317|PF00324|3e-06|26.6|263/429|AA_permease| HM:PFM:NREP 1 HM:PFM:REP 32->470|PF00324|1.3e-14|19.2|422/479|AA_permease| GO:PFM:NREP 3 GO:PFM GO:0006810|"GO:transport"|PF00324|IPR004841| GO:PFM GO:0016020|"GO:membrane"|PF00324|IPR004841| GO:PFM GO:0055085|"GO:transmembrane transport"|PF00324|IPR004841| OP:NHOMO 459 OP:NHOMOORG 185 OP:PATTERN -------------------------------------------1-1------------------1--- ----1----------------------------------1--------------------11----------111-----3-------1111-1----------------11111111111111------------------------------------------------------------------1----------------------------------12231-----------------------225-11-12-4111121223--1121-------------------------------------------------3333333132-1--1666---------------------11-------1---------------------11-1111-----------------------------------------------------------------------------------------------2------------------1--------2----------------------------1---------------1-----2-1---1--------------------------------------------2-----------------2------------------------21--41-5554544454-5555554555544455554111----1443444444444444412124442--2---------------222114444-------------------------------------------------544335434--211-----21-22-------------------------------------------1--------1----111------------1 -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 206 STR:RPRED 43.6 SQ:SECSTR ########################################################################THHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTccccHHHHHHHHHHHHHHHHHHHH##HT####HHHHHHHHH#HHHHHHHHHHHHHHHHHHHHccGGGT#######cccccHHHHHHHHHHGGGGGTHHHHHHTTGGGcccHHHHHHHHHHHHHHHHHHHHHHTTccHHHHHHTGG#GHHHHHHHHH####HHHHH##########HHHHHHHHHHHHHH##################################################################################################################################################################### DISOP:02AL 1-12, 471-472| PSIPRED cccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEccccccHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //