[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE2082
DDBJ      :CPE2082      probable ABC transporter
Swiss-Prot:             

Homologs  Archaea  15/68 : Bacteria  491/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:322 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   128->223 2r6gF PDBj 5e-07 22.9 %
:RPS:PDB   206->238 3dhwA PDBj 3e-07 24.2 %
:RPS:SCOP  75->306 2r6gF2  f.58.1.1 * 8e-15 20.2 %
:HMM:PFM   110->311 PF00528 * BPD_transp_1 3.4e-18 22.5 178/185  
:BLT:SWISS 31->321 YTEP_BACSU 1e-43 29.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81788.1 GT:GENE CPE2082 GT:PRODUCT probable ABC transporter GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2389701..2390669) GB:FROM 2389701 GB:TO 2390669 GB:DIRECTION - GB:GENE CPE2082 GB:PRODUCT probable ABC transporter GB:NOTE 322 aa, similar to gpu:AP001509_232 sugar transport system (permease) (binding protein dependent transporter) from Bacillus halodurans (312 aa); 55.6% identity in 304 aa overlap. 4 putative transmembrane regions were found by PSORT. permease protein GB:PROTEIN_ID BAB81788.1 LENGTH 322 SQ:AASEQ MKSKAKKLPKEKLTMKDRMKRFRNNKELLLLTIPGAIWFLVFAYLPMFGVIVAFKRWRIHGGFFESLMNSKWVGFDNFKFLFQSSDAWLITKNTVLYNIVFIILGIVLPVTLAILLNELLNKKLAKFYQSSMFLPYFLSWVVVSYCLYAFLSPEKGYVNGILQSMGGKGISWYTEPKYLPFIIIFMSQWKAVGYGTVVYLASICGIDKSYYEAAMIDGASKFQQIKYITVPLLKPVMIIMFITSIGGMFRGDLGLFYQLPKDSGALYPVTNVIDTYVYRGLMNLGDIGMSSAASLYQSFVGLILIVTSNAIVRKVDEENAFF GT:EXON 1|1-322:0| BL:SWS:NREP 1 BL:SWS:REP 31->321|YTEP_BACSU|1e-43|29.5|285/321| TM:NTM 6 TM:REGION 31->53| TM:REGION 100->121| TM:REGION 132->154| TM:REGION 182->204| TM:REGION 225->247| TM:REGION 291->312| SEG 2->16|kskakklpkekltmk| SEG 112->126|laillnellnkklak| BL:PDB:NREP 1 BL:PDB:REP 128->223|2r6gF|5e-07|22.9|96/490| RP:PDB:NREP 1 RP:PDB:REP 206->238|3dhwA|3e-07|24.2|33/203| HM:PFM:NREP 1 HM:PFM:REP 110->311|PF00528|3.4e-18|22.5|178/185|BPD_transp_1| RP:SCP:NREP 1 RP:SCP:REP 75->306|2r6gF2|8e-15|20.2|228/244|f.58.1.1| OP:NHOMO 1894 OP:NHOMOORG 508 OP:PATTERN ----1-----------4-------1114--2------------------------23-111221---- ----Y1-3223-1112233-3-1132333333----12232225EuO-7AA2JCA-17--4355824CJ956333E961---2-----------------------------------------------------78875---61221311-11111111111221333--1-----1----87144BC-723111111221-11121PI774711254B28246566559*-11111111111111-1---421-22--11122--22-----2123-1-22222--233324322221111111111111-33---3334D4-281111121313D2--1334Y-232239--12---1C---775F1-1--------------6541--3143222212222227---4--1-159--GHH7MLCRQMFF-----5733223432--------2--1--11---------------------------------1--21213332322----2233111--133211----1115-122214365-------2-------------------------1111---------11-122----------1------------------1-4-------3----------------------1---------1341-1-1111111111-111111111111111111121243--111111111111111113-111111--355555555555------------11-319---------------------------11111111-11111-11-------------------2-233--111111111111--------------------211111-11-111-111---112---5HE758P787-1- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------3------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 117 STR:RPRED 36.3 SQ:SECSTR ###############################################################################################################################HHHHTTHHHHccHHHHHHHHHHHTcccccHHHHHHHHTccccccTTTcHHHHHHHHHHHHHHHHHHHHHHHHHHHGGGccTTTTTHHHHHTccTHHHHHHTTHHHHHHHHHHHHHHH############################################################################## DISOP:02AL 1-23, 319-320| PSIPRED cccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcccHHEEHHHEEHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc //