[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE2104
DDBJ      :CPE2104      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  57/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:171 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   13->157 PF07456 * Hpre_diP_synt_I 2e-18 42.1 %
:HMM:PFM   13->157 PF07456 * Hpre_diP_synt_I 8.7e-48 51.0 145/148  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81810.1 GT:GENE CPE2104 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2413069..2413584) GB:FROM 2413069 GB:TO 2413584 GB:DIRECTION - GB:GENE CPE2104 GB:PRODUCT hypothetical protein GB:NOTE 171 aa, similar to pir:F72239 hypothetical protein from Thermotoga maritima (strain MSB8) (211 aa); 20.8% identity in 154 aa overlap. Putative N-terminal signal sequence and 5 putative transmembrane regions were found by PSORT. GB:PROTEIN_ID BAB81810.1 LENGTH 171 SQ:AASEQ MNNINKIVRLSILTTIALTIFMIELHIPPLVPIPGVKLGLANIITLIVLYLYGIREASTVLIIRILLGSMFSGQVVSLLYSLSGGLMCLLVMILLMKIVGKEGIWFVSVGGAIAHNIGQIIIAMILFQTTSVLYYLPVLILSGVITGVFTGLLSKYMITNKVINRLISNSL GT:EXON 1|1-171:0| TM:NTM 6 TM:REGION 5->27| TM:REGION 30->52| TM:REGION 54->76| TM:REGION 79->101| TM:REGION 106->128| TM:REGION 135->157| SEG 72->90|sgqvvsllyslsgglmcll| RP:PFM:NREP 1 RP:PFM:REP 13->157|PF07456|2e-18|42.1|145/147|Hpre_diP_synt_I| HM:PFM:NREP 1 HM:PFM:REP 13->157|PF07456|8.7e-48|51.0|145/148|Hpre_diP_synt_I| OP:NHOMO 61 OP:NHOMOORG 57 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------11----------------------------------------------------------------------------------------------------------1------------------------------------111111---------------------------------11----------111---1-------------------------------1----111--21-11111111-1-2111122-11111-11--11---111--111-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------11---1------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 170-171| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //