[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE2110
DDBJ      :CPE2110      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.38.1
:229 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  13->227 1pv7A_ f.38.1.2 * 2.5e-13 15.9 %
:RPS:PFM   77->141 PF00083 * Sugar_tr 4e-04 26.2 %
:HMM:PFM   44->226 PF07690 * MFS_1 1.4e-06 20.8 149/353  
:BLT:SWISS 35->176 EDL17_ARATH 2e-07 26.9 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81816.1 GT:GENE CPE2110 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 2420422..2421111 GB:FROM 2420422 GB:TO 2421111 GB:DIRECTION + GB:GENE CPE2110 GB:PRODUCT hypothetical protein GB:NOTE 229 aa, no significant homology 5 putative transmembrane regions were found by PSORT. GB:PROTEIN_ID BAB81816.1 LENGTH 229 SQ:AASEQ MEAGLVNLITSKDENWDKRWKYNCAMFILCYIFMGAVTGITNDSYLSYLNITVPNVVKALPTYASIGTFIIAMLLLLTHKVGFKKLILLAPILSVLGLLVCIYSKNGLIITFAYIVVNVGLGMFDCIYPVMFTSYTPRKERTKMFSRVMYCNLISQSILTFFNGKIVVWKFAKSLGVSYDNASVLSENQDALSSVQLMAYSDSYKFVLWIAIALTVIASVFLLFLKEKS GT:EXON 1|1-229:0| BL:SWS:NREP 1 BL:SWS:REP 35->176|EDL17_ARATH|2e-07|26.9|134/474| TM:NTM 4 TM:REGION 24->46| TM:REGION 52->74| TM:REGION 99->121| TM:REGION 205->226| RP:PFM:NREP 1 RP:PFM:REP 77->141|PF00083|4e-04|26.2|65/433|Sugar_tr| HM:PFM:NREP 1 HM:PFM:REP 44->226|PF07690|1.4e-06|20.8|149/353|MFS_1| GO:PFM:NREP 4 GO:PFM GO:0005215|"GO:transporter activity"|PF00083|IPR005828| GO:PFM GO:0006810|"GO:transport"|PF00083|IPR005828| GO:PFM GO:0016021|"GO:integral to membrane"|PF00083|IPR005828| GO:PFM GO:0055085|"GO:transmembrane transport"|PF00083|IPR005828| HM:SCP:REP 13->227|1pv7A_|2.5e-13|15.9|182/417|f.38.1.2|1/1|MFS general substrate transporter| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED ccccHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEEEccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //