[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE2125
DDBJ      :CPE2125      conserved hypothetical protein
Swiss-Prot:NADD_CLOPE   RecName: Full=Probable nicotinate-nucleotide adenylyltransferase;         EC=2.7.7.18;AltName: Full=Deamido-NAD(+) pyrophosphorylase;AltName: Full=Deamido-NAD(+) diphosphorylase;AltName: Full=Nicotinate mononucleotide adenylyltransferase;         Short=NaMN adenylyltransferase;

Homologs  Archaea  0/68 : Bacteria  677/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
c.26.1
:202 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->199 2qtmA PDBj 2e-33 39.6 %
:RPS:PDB   2->200 3e27A PDBj 2e-30 38.5 %
:RPS:SCOP  2->200 1k4kA  c.26.1.3 * 1e-45 29.3 %
:HMM:SCOP  1->201 1nupA_ c.26.1.3 * 8.7e-59 38.8 %
:RPS:PFM   6->173 PF01467 * CTP_transf_2 3e-13 36.2 %
:HMM:PFM   6->174 PF01467 * CTP_transf_2 1.4e-39 35.7 157/157  
:BLT:SWISS 1->202 NADD_CLOPE e-118 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81831.1 GT:GENE CPE2125 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2437344..2437952) GB:FROM 2437344 GB:TO 2437952 GB:DIRECTION - GB:GENE CPE2125 GB:PRODUCT conserved hypothetical protein GB:NOTE 202 aa, similar to gpu:AP001511_215 BH1326 gene product from Bacillus halodurans (207 aa); 37% identity in 200 aa overlap GB:PROTEIN_ID BAB81831.1 LENGTH 202 SQ:AASEQ MKKIGVFGGTFDPIHIGHIYIAYEAYKILELDEVIFMPAGNPPHKKWKDITDEIIRYEMVKKAIEPYSFFSINNYEIEKKGLSFTYETLRYLHESFKEVELYFITGADCLVNLNSWKNINEIFKFSNLVVFNRPGFDKNDLLKRKEEFDREYCTNIVYLDLLNIEISSTLIRERVRESLEVKFFLPPGVVDIIDKYNLYRRE GT:EXON 1|1-202:0| SW:ID NADD_CLOPE SW:DE RecName: Full=Probable nicotinate-nucleotide adenylyltransferase; EC=2.7.7.18;AltName: Full=Deamido-NAD(+) pyrophosphorylase;AltName: Full=Deamido-NAD(+) diphosphorylase;AltName: Full=Nicotinate mononucleotide adenylyltransferase; Short=NaMN adenylyltransferase; SW:GN Name=nadD; OrderedLocusNames=CPE2125; SW:KW ATP-binding; Complete proteome; NAD; Nucleotide-binding;Nucleotidyltransferase; Pyridine nucleotide biosynthesis; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->202|NADD_CLOPE|e-118|100.0|202/202| GO:SWS:NREP 5 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0016779|"GO:nucleotidyltransferase activity"|Nucleotidyltransferase| GO:SWS GO:0019363|"GO:pyridine nucleotide biosynthetic process"|Pyridine nucleotide biosynthesis| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| BL:PDB:NREP 1 BL:PDB:REP 1->199|2qtmA|2e-33|39.6|187/189| RP:PDB:NREP 1 RP:PDB:REP 2->200|3e27A|2e-30|38.5|187/188| RP:PFM:NREP 1 RP:PFM:REP 6->173|PF01467|3e-13|36.2|141/145|CTP_transf_2| HM:PFM:NREP 1 HM:PFM:REP 6->174|PF01467|1.4e-39|35.7|157/157|CTP_transf_2| GO:PFM:NREP 2 GO:PFM GO:0009058|"GO:biosynthetic process"|PF01467|IPR004820| GO:PFM GO:0016779|"GO:nucleotidyltransferase activity"|PF01467|IPR004820| RP:SCP:NREP 1 RP:SCP:REP 2->200|1k4kA|1e-45|29.3|198/213|c.26.1.3| HM:SCP:REP 1->201|1nupA_|8.7e-59|38.8|201/0|c.26.1.3|1/1|Nucleotidylyl transferase| OP:NHOMO 689 OP:NHOMOORG 680 OP:PATTERN -------------------------------------------------------------------- -111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111---11111111111---------------111111111111111111111-------11-----------1111----------------111111111111111111111111111111111112111111111221111111111111111111111111111111111111111111222111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111-1111111----1--------------------------------1--1-111--111-111--111-------11111111111--------11-------1-------------------11---11111-11111-111111111111111111111111111-1-----11--1111111111111111111111111111111111111111111111----1111111--1111-11-11111111-11-1111-1111111111111111111111111111--11111--11111111111111111111-11211111111111111111111111111111111111111111111111111111111111111--1111111111111111------------------------11111111111111111111---------1--------------111---1-1-----1111------11111111111----1-11111111111111111111111111111111 -1----------------------------------------------------------------------------------------------------------1----------------------------------------------------1------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 202 STR:RPRED 100.0 SQ:SECSTR ccEEEEEEEccccccHHHHHHHHHHHHHTTccEEEEEEccccTTcccTTcccHHHHHHHHHHHHTTcTTEEEccGGGcccccccHHHHHHHHHHHcTTcEEEEEEEHHHHHHGGGcTTHHHHHHHcEEEEEccTTcccGGGTTHHTTcccccccccEEEccccccccHHHHHHHHHTTcccTTTccHHHHHHHHHHTTTcHH DISOP:02AL 200-202| PSIPRED ccEEEEccccccHHHHHHHHHHHHHHHHHcccEEEEEEEcccccccccccccHHHHHHHHHHHHHccccEEEEEEEEcccccEEHHHHHHHHHHHccccEEEEEEcHHHHHHHHHHHHHHHHHHHccEEEEEcccccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHccccccccccHHHHHHHHHccccccc //