[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE2141
DDBJ      :CPE2141      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  24/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:165 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   6->152 PF04093 * MreD 1.2e-18 20.4 147/160  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81847.1 GT:GENE CPE2141 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2453167..2453664) GB:FROM 2453167 GB:TO 2453664 GB:DIRECTION - GB:GENE CPE2141 GB:PRODUCT hypothetical protein GB:NOTE 165 aa, no significant homology Putative N-terminal signal sequence and 3 putative transmembrane regions were found by PSORT. GB:PROTEIN_ID BAB81847.1 LENGTH 165 SQ:AASEQ MKRLILILICLLLFIVDNTLVPFFSIKGVYPSLLFTFAVLYALMSGYWEAVFIGVLSGFLQDVYFVNVFGVNMLVNMLVCLIAAYIGESVFKHKKTIPVLSVGLLTIIKFFIVAFILNLINIRINLLSFWIMVLYNVVIGFFMYNWVYKLCNRDLMKREWKISEK GT:EXON 1|1-165:0| TM:NTM 4 TM:REGION 13->35| TM:REGION 59->81| TM:REGION 96->118| TM:REGION 124->146| SEG 4->15|lililiclllfi| SEG 116->127|ilnlinirinll| HM:PFM:NREP 1 HM:PFM:REP 6->152|PF04093|1.2e-18|20.4|147/160|MreD| OP:NHOMO 24 OP:NHOMOORG 24 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111111--111111-1------------------111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 163-165| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //