[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE2147
DDBJ      :CPE2147      conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  397/915 : Eukaryota  12/199 : Viruses  0/175   --->[See Alignment]
c.6.3
:272 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->250 3e0fA PDBj 6e-17 25.2 %
:RPS:PDB   1->250 3e0fA PDBj 1e-22 21.7 %
:RPS:SCOP  4->249 2anuA1  c.6.3.1 * 6e-33 25.8 %
:HMM:SCOP  1->250 2anuA1 c.6.3.1 * 2.7e-41 36.6 %
:RPS:PFM   7->102 PF02811 * PHP 4e-11 35.4 %
:RPS:PFM   156->237 PF10566 * Glyco_hydro_97 2e-04 26.2 %
:HMM:PFM   7->202 PF02811 * PHP 4.4e-21 28.9 128/175  
:HMM:PFM   175->239 PF10566 * Glyco_hydro_97 0.0002 26.6 64/643  
:BLT:SWISS 7->249 TRPH_SALTY 9e-18 25.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81853.1 GT:GENE CPE2147 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2458182..2459000) GB:FROM 2458182 GB:TO 2459000 GB:DIRECTION - GB:GENE CPE2147 GB:PRODUCT conserved hypothetical protein GB:NOTE 272 aa, similar to gpu:AP001515_17 BH2283 gene product from Bacillus haloduran (290 aa); 29.3% identity in 249 aa overlap GB:PROTEIN_ID BAB81853.1 LENGTH 272 SQ:AASEQ MNLVRTDLHMHTRASDGTLTPKELLKEIVEKDIKLFSVTDHDSIGSLEEMQDLTEEMDIKFIPGVEVSSIINGEQFHILAYNFDKNNKELMSLIENNDRLLQEKDDNSIKQLIDAGYDIDFEDYLSYEHDPSKGGWKTLNFLIDRGICKNIDEFFNKIFVGERALKYPDFPHPKEVIETIKKANGIVVLAHPKYGKSQFKLDEMLELFKNWGVDGIECYHPHHDEDTIKYLVDYCTKNNLIITGGSDYHGGLISKRSLGTPEFYAKYDLLDK GT:EXON 1|1-272:0| BL:SWS:NREP 1 BL:SWS:REP 7->249|TRPH_SALTY|9e-18|25.1|243/293| BL:PDB:NREP 1 BL:PDB:REP 7->250|3e0fA|6e-17|25.2|238/282| RP:PDB:NREP 1 RP:PDB:REP 1->250|3e0fA|1e-22|21.7|249/282| RP:PFM:NREP 2 RP:PFM:REP 7->102|PF02811|4e-11|35.4|96/177|PHP| RP:PFM:REP 156->237|PF10566|2e-04|26.2|80/641|Glyco_hydro_97| HM:PFM:NREP 2 HM:PFM:REP 7->202|PF02811|4.4e-21|28.9|128/175|PHP| HM:PFM:REP 175->239|PF10566|0.0002|26.6|64/643|Glyco_hydro_97| GO:PFM:NREP 1 GO:PFM GO:0003824|"GO:catalytic activity"|PF02811|IPR004013| RP:SCP:NREP 1 RP:SCP:REP 4->249|2anuA1|6e-33|25.8|182/224|c.6.3.1| HM:SCP:REP 1->250|2anuA1|2.7e-41|36.6|161/0|c.6.3.1|1/1|PHP domain-like| OP:NHOMO 439 OP:NHOMOORG 410 OP:PATTERN -----------------------1-------------------------------------------- --111-------------------------------1111-2-11-11111111-111--11111-111111111111--1---------------------------1---------------111111111111----1111-2--1------11---------1-------1-----1---------1-------------------2-----------1--------11------------------------------------------------------------------------------------------112132222222222111112221-11111-2122211121121112---1------------------------------------------------------------------------------------------------------------------------------1111111111111111111111111111111111111111111111111111-1111111111111111-1-11111111111111-1-11111111111-1--------------------------11112111111111111111111111111111---111--------1111111111111111-111111111111111111111111112-1111111111111111111-1111-111111111111--11-----1111111-1111-111111111111111111111111111111111111-111---------111111111111111---------------1----------------1---------------------------11111-------- -----------1--------------------------------------------------------------------------------------------------------------------------------------------------1----1----------------------111-11--1111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 272 STR:RPRED 100.0 SQ:SECSTR cccccEEEEEccTTTTccccHHHHHHHHHHTTccEEEEEEETccTTHHHHHHHHHHHTccEEEEEEEEEEETTEEEEEEEcccTETcHHHHHHHHHHHHHHHHHHHHHHHTTTccccHHHHHTTcccGGGccccHHHHHHHHHHTTccccHHHHTTTTcTTcTTccccccccHHHHHHHHHHTTcEEEEEcTccccccccccHHHHHHHHHTccEEEEEcTTccHHHHHHHHHHHHHHTcEEEEcccccGGGGccEEEEEEEcccHHHHHHH DISOP:02AL 272-273| PSIPRED cccEEEEEEEccccccccccHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHHcccEEEEEEEEEEEcccEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHccccccHHHHHHHHHHccccccHHHHHHHHccccccccccccccHHHHHHHHHHcccEEEEEccccccccHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHHccEEEEEcccccccccccccccccHHHHHHHHcc //