[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE2152
DDBJ      :CPE2152      conserved hypothetical protein
Swiss-Prot:Y2152_CLOPE  RecName: Full=UPF0246 protein CPE2152;

Homologs  Archaea  0/68 : Bacteria  368/915 : Eukaryota  14/199 : Viruses  0/175   --->[See Alignment]
:254 amino acids
:PSIPRED
:RPS:PFM   1->244 PF03883 * DUF328 3e-58 48.1 %
:HMM:PFM   1->244 PF03883 * DUF328 8e-82 49.8 237/237  
:BLT:SWISS 1->254 Y2152_CLOPE e-147 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81858.1 GT:GENE CPE2152 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2464043..2464807) GB:FROM 2464043 GB:TO 2464807 GB:DIRECTION - GB:GENE CPE2152 GB:PRODUCT conserved hypothetical protein GB:NOTE 254 aa, similar to sp:YAAA_HAEIN HYPOTHETICAL PROTEIN HI0984 from Haemophilus influenzae (strain Rd KW20) (272 aa); 43.5% identity in 255 aa overlap GB:PROTEIN_ID BAB81858.1 LENGTH 254 SQ:AASEQ MIALLSPAKTLDLTKPNLNIETSKPIFISEAEVIMNNLKELEIQDLCPLMKISEDLGVQTFTKIQDWNTIYYGDEKPFVLSFKGEAYRGLDADDFTKEDLEFCNDSLRILSGLYGALKPLDGTKAYRLEMGTKISIDGSKNLYDFWGNKIMEAVLKDLENHKEKVIINLASNEYYKSIKKIDKKVRVITPVFKERKGIEYKVVTVYAKKARGQMVRYITKNRITKSEDIKNFDLDGYEFNERLSEGDTWVFTRD GT:EXON 1|1-254:0| SW:ID Y2152_CLOPE SW:DE RecName: Full=UPF0246 protein CPE2152; SW:GN OrderedLocusNames=CPE2152; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->254|Y2152_CLOPE|e-147|100.0|254/254| RP:PFM:NREP 1 RP:PFM:REP 1->244|PF03883|3e-58|48.1|239/239|DUF328| HM:PFM:NREP 1 HM:PFM:REP 1->244|PF03883|8e-82|49.8|237/237|DUF328| OP:NHOMO 386 OP:NHOMOORG 382 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------11------------------11------1111-111---111111-----------------------------------------11----------------------------------------------------------------------------------------------------------1111111111111111-11------1111111111111111111111111-11------1--1111111----1-------1-1-1---1111--11-11--11-------------11---1111--------------------------------------------------------1-111-1111111----------------------------1-11-11-1-11--------1--111111111111-111111111111111111111111111111111111111----111111111---111--1-1------------------------------------------------------111111111111111111111111111111-------------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111--1------1111-1111111111-1111111121111111111111111111111111111111111111111111111111111----------------1-----------------1----------------1-1------------------- ------1-----------------------------------------------------------------------------------------------------2----------------------------------------------------------------2----12111---------111111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cEEEEccHHcccccccccccccccHHHHHHHHHHHHHHHHccHHHHHHHHcccHHHHHHHHHHHHHHHHHccccHHHHHHHHcHHHHHcccHHHccHHHHHHHHHHHHHHHHHHHHcccccccccEEEEccccccccccccHHHHHHHHHHHHHHHHHHHccccEEEEcccHHHHHHccHHHHccEEEEEEEEEccccEEEEEHHHHHHHHHHHHHHHHHcccccHHHHHHccccccEEcHHHccccccEEEcc //