[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE2163
DDBJ      :CPE2163      conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  65/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.37.1d.58.18
:206 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   3->129 1yavB PDBj 3e-09 27.2 %
:BLT:PDB   147->197 2p4eA PDBj 6e-04 29.4 %
:RPS:PDB   3->186 3c1yA PDBj 2e-11 9.9 %
:RPS:SCOP  1->128 1yavA3  d.37.1.1 * 1e-14 25.4 %
:RPS:SCOP  139->200 1phzA1  d.58.18.3 * 3e-06 12.9 %
:HMM:SCOP  1->61 1yavA1 d.37.1.1 * 1.5e-08 23.0 %
:HMM:SCOP  62->132 1yavA2 d.37.1.1 * 7.6e-10 26.1 %
:HMM:SCOP  137->206 1y7pA2 d.58.18.12 * 2e-06 27.1 %
:RPS:PFM   19->173 PF00478 * IMPDH 2e-05 26.4 %
:HMM:PFM   3->57 PF00571 * CBS 1.3e-10 26.4 53/57  
:HMM:PFM   74->127 PF00571 * CBS 1.7e-10 25.9 54/57  
:HMM:PFM   140->199 PF01842 * ACT 4.1e-08 25.0 60/66  
:BLT:SWISS 3->136 YKUL_BACSU 8e-09 28.0 %
:REPEAT 2|10->58|79->128

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81869.1 GT:GENE CPE2163 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2480759..2481379) GB:FROM 2480759 GB:TO 2481379 GB:DIRECTION - GB:GENE CPE2163 GB:PRODUCT conserved hypothetical protein GB:NOTE 206 aa, similar to pir:H72290 conserved hypothetical protein from Thermotoga maritima (strain MSB8) (215 aa); 31.2% identity in 205 aa overlap GB:PROTEIN_ID BAB81869.1 LENGTH 206 SQ:AASEQ MLVKAIMTKKENLDLVDSNTKLKDALKIMEDNKFLSIPVVDGDKFRGAVAKSSIYKYYFKHNLSKDEVLNNITVGEILKTEVPIINKSEHIEKAVSMLERMRISFVAVVDEFDNFKGILTHKAVFREFNNAFGLNKGERIVIRSYDVPGQLSKITKTISEEGGDILSIVIVDTKSLTDVKEVIVRVKSIDVENIKKKLKESGFKLA GT:EXON 1|1-206:0| BL:SWS:NREP 1 BL:SWS:REP 3->136|YKUL_BACSU|8e-09|28.0|132/147| NREPEAT 1 REPEAT 2|10->58|79->128| BL:PDB:NREP 2 BL:PDB:REP 3->129|1yavB|3e-09|27.2|125/135| BL:PDB:REP 147->197|2p4eA|6e-04|29.4|51/494| RP:PDB:NREP 1 RP:PDB:REP 3->186|3c1yA|2e-11|9.9|182/349| RP:PFM:NREP 1 RP:PFM:REP 19->173|PF00478|2e-05|26.4|140/459|IMPDH| HM:PFM:NREP 3 HM:PFM:REP 3->57|PF00571|1.3e-10|26.4|53/57|CBS| HM:PFM:REP 74->127|PF00571|1.7e-10|25.9|54/57|CBS| HM:PFM:REP 140->199|PF01842|4.1e-08|25.0|60/66|ACT| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00478|IPR001093| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00478|IPR001093| RP:SCP:NREP 2 RP:SCP:REP 1->128|1yavA3|1e-14|25.4|126/132|d.37.1.1| RP:SCP:REP 139->200|1phzA1|3e-06|12.9|62/97|d.58.18.3| HM:SCP:REP 1->61|1yavA1|1.5e-08|23.0|61/0|d.37.1.1|1/2|CBS-domain| HM:SCP:REP 62->132|1yavA2|7.6e-10|26.1|69/0|d.37.1.1|2/2|CBS-domain| HM:SCP:REP 137->206|1y7pA2|2e-06|27.1|70/0|d.58.18.12|1/1|ACT-like| OP:NHOMO 70 OP:NHOMOORG 65 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-11-1---------1--1---11---------------111111111-1-------------------2111111111111----1-1-1------1----111------------------------1-1---1111--1-----------------1111------------1-2------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------22---1--1211------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 200 STR:RPRED 97.1 SQ:SECSTR TTccHHHHHccHHGGGcTTcHHHHHHHHHHHTTccEEEEEcccGGGTTTEccEEEEEEccHHHHHHHTTcccEEEEcTTccEEEEEEEEEcccTTccccccHHHHHHHHHHHccEEEEEccccccEEEccEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTcccHHHHHHHHHHHcccccHHHHHHHHH###### PSIPRED ccHHHccccccccEEEcccccHHHHHHHHHHccccEEEEEEccEEEEEEEHHHHHHHHHcccccHHHHHccccHHHHHccccEEEcccccHHHHHHHHHHccccEEEEEccccEEEEEEEHHHHHHHHHHHcccccccEEEEEEccccccHHHHHHHHHHccccEEEEEEEEccccccEEEEEEEEEcccHHHHHHHHHHcccccc //