[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE2178
DDBJ      :CPE2178      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:214 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   8->128 PF02932 * Neur_chan_memb 1.4e-06 18.2 121/237  
:HMM:PFM   104->181 PF07220 * DUF1420 0.00021 32.5 77/670  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81884.1 GT:GENE CPE2178 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2500946..2501590) GB:FROM 2500946 GB:TO 2501590 GB:DIRECTION - GB:GENE CPE2178 GB:PRODUCT hypothetical protein GB:NOTE 214 aa, no significant homology Putative N-terminal signal sequence was found by PSORT GB:PROTEIN_ID BAB81884.1 LENGTH 214 SQ:AASEQ MNKGPLSFLVLFFTTLIIGTMTYFVNLNYEEAKLKAESVKSQKNEILNINEEENGQKAIENNKEELKEDREKENISENNNKQSNDLDKSQLKEEKEIEGKSKENATNIKKNEKSKEKVAEEKSSKESKEVFKVDKYSIPKKINKADKFKLMSIAKNLSLTDYGVLLEHIKRNDELDAAIDIFKILKDKLEEKEYKEMKDILSPYINIELIEEKI GT:EXON 1|1-214:0| SEG 44->54|neilnineeen| SEG 92->103|keekeiegkske| SEG 109->135|kknekskekvaeeksskeskevfkvdk| SEG 183->199|kilkdkleekeykemkd| HM:PFM:NREP 2 HM:PFM:REP 8->128|PF02932|1.4e-06|18.2|121/237|Neur_chan_memb| HM:PFM:REP 104->181|PF07220|0.00021|32.5|77/670|DUF1420| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 30-133| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHccHHHHHHHHHcccHHHHHHHccccccHHcccHHHHHHHHccHHcccccHHHHHcccccccccHHHccHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //