[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE2179
DDBJ      :CPE2179      conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  76/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.56.1
:176 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  1->176 1c8bA_ c.56.1.2 * 1.4e-42 33.0 %
:RPS:PFM   6->164 PF06866 * DUF1256 2e-40 52.8 %
:HMM:PFM   6->163 PF06866 * DUF1256 1.7e-68 50.6 158/164  
:BLT:SWISS 17->165 YYAC_BACSU 6e-28 38.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81885.1 GT:GENE CPE2179 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 2501696..2502226 GB:FROM 2501696 GB:TO 2502226 GB:DIRECTION + GB:GENE CPE2179 GB:PRODUCT conserved hypothetical protein GB:NOTE 176 aa, similar to sp:YYAC_BACSU HYPOTHETICAL 22.5 KDA PROTEIN IN RPSF-SPO0J INTERGENIC REGION from Bacillus subtilis (205 aa); 38.9% identity in 149 aa overlap GB:PROTEIN_ID BAB81885.1 LENGTH 176 SQ:AASEQ MNKIKIYYKNYLAYYEISNFLKNHIDEKTIIVCIGTDKCIGDCLGPLVGTLLKEKFFPLKVFGTLDSPIHALNLDKKITEILKTYPGYKILAIDACLGDSNSIGEIHARNEPIHPGKGVGKSLRSVGDMSIIAIVDSSENIDLFTSRPIRLSFILDMSKVIVDSLIHSYYLKNKKN GT:EXON 1|1-176:0| BL:SWS:NREP 1 BL:SWS:REP 17->165|YYAC_BACSU|6e-28|38.9|149/100| RP:PFM:NREP 1 RP:PFM:REP 6->164|PF06866|2e-40|52.8|159/165|DUF1256| HM:PFM:NREP 1 HM:PFM:REP 6->163|PF06866|1.7e-68|50.6|158/164|DUF1256| HM:SCP:REP 1->176|1c8bA_|1.4e-42|33.0|176/0|c.56.1.2|1/1|HybD-like| OP:NHOMO 110 OP:NHOMOORG 76 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111111111111222-111------12-------------------------------------------------------------------------------------------2132222223223211222222122--1--111121221111222------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 174-176| PSIPRED cHHHHHHHccHHHHHHHHHHHHHHccccEEEEEEcccccccccHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHccccEEEEEEEcccccccccEEEEccccccccccccccccccccEEEEEEEccccHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHccc //