[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE2203
DDBJ      :CPE2203      conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  875/915 : Eukaryota  86/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:569 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   303->562 1sg9A PDBj 3e-27 35.5 %
:RPS:PDB   301->564 2b3tA PDBj 2e-28 27.8 %
:RPS:SCOP  301->564 1t43A  c.66.1.30 * 3e-72 29.3 %
:HMM:SCOP  285->563 1t43A_ c.66.1.30 * 1.8e-63 34.9 %
:RPS:PFM   35->278 PF07136 * DUF1385 8e-66 51.7 %
:RPS:PFM   399->540 PF05175 * MTS 2e-17 41.1 %
:HMM:PFM   35->278 PF07136 * DUF1385 3.8e-96 50.4 234/237  
:HMM:PFM   388->535 PF05175 * MTS 4.6e-18 33.1 124/170  
:BLT:SWISS 2->285 YQHQ_BACSU 5e-39 34.9 %
:BLT:SWISS 284->561 HEMK_BACSU 2e-36 36.6 %
:PROS 469->475|PS00092|N6_MTASE
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81909.1 GT:GENE CPE2203 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2522229..2523938) GB:FROM 2522229 GB:TO 2523938 GB:DIRECTION - GB:GENE CPE2203 GB:PRODUCT conserved hypothetical protein GB:NOTE 569 aa, N-terminal region is similar to pir:A72239 conserved hypothetical protein from Thermotoga maritima (strain MSB8) (296 aa); 39.9% identity in 293 aa overlap. ATC start. 4 putative transmembrane regions were found by PSORT. GB:PROTEIN_ID BAB81909.1 LENGTH 569 SQ:AASEQ MKRKQLQQVRTPEGDIEGSFEKTIPYTKKNKILGLPFIRGFVTLIESLIVGLKSLNYSASFFDDTEPSKFEDWLNNKFGEKANNVIMTLTIMLSFVFAIILFVAIPTGITFLLKKLNLPDWSLSAIEGIISIGMLLGYMYLMGKVDDIERVFQYHGAEHKTIFCYENEDELTVENVRKYPRFHPRCGTNFLFLVAIVSIFIFSFTKWDSVAQRTAIRVAMLPVISGITYELIRWLGKSQGNFAKIIAAPGLQLQKLTTREPDDSQIEVAIASLRRAEGLKEPNKKVGELLNLGNETLKEVGIDTYILDTQLLLGKVLEKDKIWLITNKSEEVKKSDEIHFLNLLEKRKLKMPMQYILGTCEFMGLDFYVEEGVLIPRGDTEIIVEEVLNNIDEDAEINVCDLCCGSGAIGLSLANYRKNIIVDLVDIDDIPEKVTRKNIRELELSKRCGFIKSDLLSEVIKKGNKYDILVSNPPYIRTEVINTLMEDVKDYEPHLALDGGEDGLIFYRRIIDESLEVLKENGILAFEIGHDQGEDVKNLMIEKGYYDVKVIKDLAGLDRCVIGRVSLER GT:EXON 1|1-569:0| BL:SWS:NREP 2 BL:SWS:REP 2->285|YQHQ_BACSU|5e-39|34.9|281/318| BL:SWS:REP 284->561|HEMK_BACSU|2e-36|36.6|273/288| PROS 469->475|PS00092|N6_MTASE|PDOC00087| TM:NTM 5 TM:REGION 35->57| TM:REGION 88->110| TM:REGION 122->144| TM:REGION 185->207| TM:REGION 210->232| SEG 420->430|iivdlvdiddi| BL:PDB:NREP 1 BL:PDB:REP 303->562|1sg9A|3e-27|35.5|245/274| RP:PDB:NREP 1 RP:PDB:REP 301->564|2b3tA|2e-28|27.8|259/276| RP:PFM:NREP 2 RP:PFM:REP 35->278|PF07136|8e-66|51.7|234/238|DUF1385| RP:PFM:REP 399->540|PF05175|2e-17|41.1|129/154|MTS| HM:PFM:NREP 2 HM:PFM:REP 35->278|PF07136|3.8e-96|50.4|234/237|DUF1385| HM:PFM:REP 388->535|PF05175|4.6e-18|33.1|124/170|MTS| GO:PFM:NREP 1 GO:PFM GO:0008168|"GO:methyltransferase activity"|PF05175|IPR007848| RP:SCP:NREP 1 RP:SCP:REP 301->564|1t43A|3e-72|29.3|259/275|c.66.1.30| HM:SCP:REP 285->563|1t43A_|1.8e-63|34.9|272/0|c.66.1.30|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 1392 OP:NHOMOORG 961 OP:PATTERN -------------------------------------------------------------------- 1221211111111--1111-1-1111111111111111221-2111211-1-2--1-1111-212-112111---1111222211111111111111--1111111111111111111111111111111111111222222222211111111111111111111111111111111111111111222112222222222222222212222222222221222222222211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121221222222222222222111222122222211222222222222122121111111111112222222222211111111111-1111111122112111112111221-111111111111111111111-11111211111111111-1111111111111111111---11222222222221222222222222222222222222222212222222222222222222212222222221111111222222112222222121111121111-1111111111111111111111112222212222222222222222222222222-2212311111121222222222222222-222222222222222222222222332222211211122222222222222111222222222222222111112222122221112211222212221122112222222222222322222222222222222222222222222222222222222222222-122--111111-111111-1----1-111-111111111-111-12222222222121 ----11--111---1--1-------------------------------------1-------11-111--111-11111-11--11-------111--1---221-1-1111111-1--1-1-11121341-111-11-1---------11-1121-2---11---1-11--111-1---11--11-21111-1111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 385 STR:RPRED 67.7 SQ:SECSTR ##################################################################################################################################################################################cTTcccccccccEEccTTccccEEEEEEE###EEccGGG###HHHHcTTccTTGGGcTTcEEEEEEccHHHHHHHHHTTcccEEccGGGccTTcEEEEEEEccGGGcHHHHHHEEEEEEGGGTcccHHHHHHHHHHHHHTccHHHHHHTTTccccHHHHHHHHHHHHHHHTTccHHHHccEEEETTEEEEccTTcccccTTHHHHHHHHHHHccccccHEEEEETcTTcHHHHHHHHHcTTcEEEEEcccHHHHHHHHHHHHHHTcccEEEEcccTTGHEEGGTTccEEEEEEccccccTTcHHHHccGGGEccccTTTccHHHHTHHHHHHHHHHGGGEEEEEEEEEEcccccHHHHHHHHHHTTcTTccEEEcTTccEEEEEEEccccc DISOP:02AL 1-3, 66-67, 71-72| PSIPRED cccEEEEEEEccccEEEEEEEccccccHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHccHHHHHHHHHHccccccHHHHHccccccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHccccccccHHHHHHHHHHHHHHHHcccHHHHHcccccccccEEEcccEEccccHHHHHHHHHHHHHHcccccEEEEEcccHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHccccccEEEEEcccHHHcccccccEEEEEEcccccccHHHHHHHHHHHHcccHHHHcccccHHHHHHHHHHHHHHHHccccEEEEEEccccHHHHHHHHHHccccEEEEEEccccccEEEEEEEcccc //