[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE2216
DDBJ      :CPE2216      conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  119/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:78 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   17->70 3fb9A PDBj 3e-05 38.9 %
:RPS:PFM   7->76 PF06257 * DUF1021 1e-14 55.7 %
:HMM:PFM   5->76 PF06257 * DUF1021 2.6e-33 56.9 72/76  
:BLT:SWISS 6->76 VEG_BACSU 7e-17 46.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81922.1 GT:GENE CPE2216 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2538540..2538776) GB:FROM 2538540 GB:TO 2538776 GB:DIRECTION - GB:GENE CPE2216 GB:PRODUCT conserved hypothetical protein GB:NOTE 78 aa, similar to sp:VEG_BACSU VEG PROTEIN from Bacillus subtilis (86 aa); 45.2% identity in 73 aa overlap GB:PROTEIN_ID BAB81922.1 LENGTH 78 SQ:AASEQ MSTRLTLNSIRKSIEDHVGEKVKLRANGGRKKILENEGILESVHPSIFVVRLQKDTQRKVTYSYSDVLTKTVQLDFVG GT:EXON 1|1-78:0| BL:SWS:NREP 1 BL:SWS:REP 6->76|VEG_BACSU|7e-17|46.5|71/100| BL:PDB:NREP 1 BL:PDB:REP 17->70|3fb9A|3e-05|38.9|54/89| RP:PFM:NREP 1 RP:PFM:REP 7->76|PF06257|1e-14|55.7|70/76|DUF1021| HM:PFM:NREP 1 HM:PFM:REP 5->76|PF06257|2.6e-33|56.9|72/76|DUF1021| OP:NHOMO 119 OP:NHOMOORG 119 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------111--------------------------------------------------------------------------------------------------------------111111111111111111111111111111111111111111-11111111111111111111111111-1-111111111-111-----------------------------------------------11111111111111111111111--1111---------111-11111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 54 STR:RPRED 69.2 SQ:SECSTR ################TTTcEEEEEEcccccccccEEEEEEEEcccEEEEEcTTccccccEEEHHHHHTT######## DISOP:02AL 1-4| PSIPRED ccccHHHHHHHHHHHHccccEEEEEEcccEEEEEEEEEEEEEEccEEEEEEccccccEEEEEEEEEEEEEEEEEEEEc //